%PDF-1.6 % 2 0 obj << /Type /Catalog /Pages 4 0 R /Metadata 5 0 R >> endobj 5 0 obj << /Type /Metadata /Length 142929 /Subtype /XML >> stream 2013-02-28T09:48:06-05:00 2013-02-28T08:48:44-06:00 2015-05-11T08:40:57-05:00 Adobe Illustrator CS5 1 JPEG 256 256 /9j/4AAQSkZJRgABAgEASABIAAD/7QAsUGhvdG9zaG9wIDMuMAA4QklNA+0AAAAAABAASAAAAAEA AQBIAAAAAQAB/+4AE0Fkb2JlAGSAAAAAAQUAAgAD/9sAhAAMCAgICAgMCAgMEAsLCxAUDg0NDhQY EhMTExIYFBIUFBQUEhQUGx4eHhsUJCcnJyckMjU1NTI7Ozs7Ozs7Ozs7AQ0LCxAOECIYGCIyKCEo MjsyMjIyOzs7Ozs7Ozs7Ozs7Ozs7OztAQEBAQDtAQEBAQEBAQEBAQEBAQEBAQEBAQED/wAARCAEA AMYDAREAAhEBAxEB/8QBQgAAAQUBAQEBAQEAAAAAAAAAAwABAgQFBgcICQoLAQABBQEBAQEBAQAA AAAAAAABAAIDBAUGBwgJCgsQAAEEAQMCBAIFBwYIBQMMMwEAAhEDBCESMQVBUWETInGBMgYUkaGx QiMkFVLBYjM0coLRQwclklPw4fFjczUWorKDJkSTVGRFwqN0NhfSVeJl8rOEw9N14/NGJ5SkhbSV xNTk9KW1xdXl9VZmdoaWprbG1ub2N0dXZ3eHl6e3x9fn9xEAAgIBAgQEAwQFBgcHBgI7AQACEQMh MRIEQVFhcSITBTKBkRShsUIjwVLR8DMkYuFygpJDUxVjczTxJQYWorKDByY1wtJEk1SjF2RFVTZ0 ZeLys4TD03Xj80aUpIW0lcTU5PSltcXV5fVWZnaGlqa2xtbm9ic3R1dnd4eXp7fH1+f3/9oADAMB AAIRAxEAPwD0Xp/T8A4GMTjUkmmuT6bf3R5JKbH7P6f/ANxqf+22/wBySlfs/p//AHGp/wC22/3J KV+z+n/9xqf+22/3JKV+z+n/APcan/ttv9ySlfs/p/8A3Gp/7bb/AHJKV+z+n/8Acan/ALbb/ckp X7P6f/3Gp/7bb/ckpX7P6f8A9xqf+22/3JKV+z+n/wDcan/ttv8AckpX7P6f/wBxqf8Attv9ySlf s/p//can/ttv9ySlfs/p/wD3Gp/7bb/ckpX7P6f/ANxqf+22/wBySlfs/p//AHGp/wC22/3JKV+z +n/9xqf+22/3JKV+z+n/APcan/ttv9ySlfs/p/8A3Gp/7bb/AHJKV+z+n/8Acan/ALbb/ckpX7P6 f/3Gp/7bb/ckpX7P6f8A9xqf+22/3JKV+z+n/wDcan/ttv8AckpX7P6f/wBxqf8Attv9ySlfs/p/ /can/ttv9ySmvk9PwBdixjU63Gf0bf8ARW+SSmx0/wD5Pxv+Jr/6kJKbCSlJKUkpSSlJKUkpSSlJ KUkpSSlJKUkpSSlJKUkpSSlJKUkpSSlJKUkpSSlJKa+T/PYn/HH/AM9XJKV0/wD5Pxv+Jr/6kJKb CSnl83/GF0bp3Xx9X8yjLptdcygZD62tx91kbXb3WA7dedqSluk/4xOh9b6tZ0vp9WVY2kv9TNLG DFa1odD3WepIa4iGy3VJT0bc3DfS7IZfU6pmjrA9paPi6YSU5/UPrX9XeluoZm59TDkvFdQZNsuM RPpB+0a8nRJTofa8QPNZur3hvqFu8Ts53RPHmkpVOXi5ABx7q7QSQNjw6SIJGh7SkpMkpz6LchnT rrcdnrXNuydjCeYvsAEpKaX7T+s3/lY3/PH/AJJJSfBzuuXZTK8zBbRS6d9gcDEAkaT4pKdZJSkl KSUpJSklKSUpJSklKSUpJSklKSU18n+exP8Ajj/56uSUrp//ACfjf8TX/wBSElJbbWUsNj5gEDQE kkmAAB4kpKfMLPqRm9dzeqdR6/l9PN2ZYy6j7La87X4oLTUXP2lrPTMOIkjQ9klI8b6g/WSjC6ni /aOk0s6rfS+yurcW7WOfY2lnqVOFbRPt9rjokpqt/wAXvW2Y2fhMyelOw825mVByHsfWKjY2ot9O htUfpodNceEaQlMqP8WfUm2YFj7OlZLcJz7M9rnua13vO5sV1skNYBqSNdOElPM4eCz7JR1PK6hj UZVhssFdnqWPsbY41F+R6VW6usifzjIgbRMlKd/6ndc+r31Kux2ZdNeVmZT7mWdRo9dobjkVmrYy 6pofve0iQG6Qkp9goyK8lhdXI2na5rhBaYDoPyISU0Ird0jJbc2x7Ddk7m062Eevb9HzSU4P2fpH /cXq3+aP70lK+z9I/wC4vVv80f3pKV9n6R/3F6t/mj+9JSvs/SP+4vVv80f3pKV9n6R/3F6t/mj+ 9JSvs/SP+4vVv80f3pKTYjumYeQzJqxOqF9ZkB7ARqI1E+aSnU/5yVf9wc7/ALZH/k0lK/5yVf8A cHO/7ZH/AJNJTpYmSMzHZkNrfUHz7LRteIJbqJPgkpMkpSSlJKUkpr5P89if8cf/AD1ckpXT/wDk /G/4mv8A6kJKSXVC6vZuczUODmRILSHDkEdklNAfV/pwe6wtcXPc9ziXEkmwAO79wElNg9NxjIgw 5zXEDQSz6Og0SUjPRcH2lrSwsDWtLHFhAaZGrSElM2dLxGU34+0OpynPdfW8B7XmzR+5rw4QfDhJ TWr+q31fpcx9PTsOt1bt7HMxqWlrh+c0ivQpKWd9VugOmen4Z3TM41BncZd/g+6Sm/h4dOFUaaAG tJmAGtAgBoAaxrWgANA4SUjFL7cK2nHs+zve+3bY0TtJseZjRJTQ/YvWf/Liz/tof+lElK/YvWf/ AC4s/wC2h/6USUr9i9Z/8uLP+2h/6USUr9i9Z/8ALiz/ALaH/pRJSv2L1n/y4s/7aH/pRJSv2L1n /wAuLP8Atof+lElK/YvWf/Liz/tof+lElK/YvWf/AC4s/wC2h/6USUr9i9Z/8uLP+2h/6USUr9i9 Z/8ALiz/ALaH/pRJSv2L1n/y4s/7aH/pRJSv2L1n/wAuLP8Atof+lElK/YvWf/Liz/tof+lElNnp /T8/EudZlZ7sthaWitzNoBkHdO53gkps5P8APYn/ABx/89XJKV0//k/G/wCJr/6kJKbCSlJKUkpS SliQBJ0A7pKWbYxxhrgT4AykpkkpSSlJKUkpSSlJKUkpSSlJKUkpSSlJKUkpSSlJKUkpSSmvk/z2 J/xx/wDPVySldP8A+T8b/ia/+pCSmWU57av0bixxfW3cIJAc9rT9IEcFJTz2RmdUyM/Kqxc+6qnG eKGtrqoc4vADnF7rWEcugAJKcXC+txz8qzDxes5dttMl7RRijQO2GP0PiUkW73TuqZRZkjIyci70 mtfU/wCzjd7mk7bBXTt0I50lJKvrV9YmdN6ZblCt76WscbmW0WN3D2gAGwVjv4pKec+qn1pZ1XJu d07Gpx30bWveGEyLOwPqeSKHp7+pZzLrGtyLQGuIAGE5wAB/e9TX4oJYftTP/wC5F3/sA7/0okp3 2WMfG1wJImJ1SU4X/Nzqn/l1kf8AT/8ASySlf83Oqf8Al1kf9P8A9LJKV/zc6p/5dZH/AE//AEsk pX/Nzqn/AJdZH/T/APSySlf83Oqf+XWR/wBP/wBLJKV/zc6p/wCXWR/0/wD0skp32gtaATJAifFJ TR6uyx2PuqyH47mSQGFoNhj6Mv0SU4PrdV/0+V/27R/5JJCvW6r/AKfK/wC3aP8AySSm3h15eQ1z r+pXYxaYAe+p0+ftJSS3sOr7NcLbeqHIbBHpvcyNe+iSm99rxf8ATV/5w/vSUkY9j2h7HBzTwQZC SkOT/PYn/HH/AM9XJKRY+TRidKx78l4rrbTWC53GrWhJS5zMbNxhbi2C1guqaXN4kPrMfikp5HPs yMTA69fQ91V7Mq99djGeq5pJqgtr/O0SUXnm5WbVmONNtlZfk4jCWYLWkttZusYXCNHEST2RQ930 w7TnM/4AE/IPAQSt9Z8PrmZmdNHTPTdiNN325lgkuBFfp7dPEHukp5vC6H9eqxgi00NLchxzC1oG +mW7RoBrz/eih3cnFyDkWkdPa8F7iHfZWunU6z9oEoKVi9PvyLW1uwaqWnUvtxGtaO/a9x/BJLv4 /TsDFs9XGx66nxG5jQDB7JKeW/abv/LLO/7Yb/6USUr9pu/8ss7/ALYb/wClElOri9O6hl47Mmvq t4ZYNwDqwD8xuSUl/Y3VP/La7/MH/kklK/Y3VP8Ay2u/zB/5JJSv2N1T/wAtrv8AMH/kklOrSx1d LK3vNjmNDXPOhcQILj8UlNbqmNTkYlnq1ix1bS6v9GLSHRy1h5Pkkp5n7G7/AEN3/uMb/wCTSU2s Loj8xriCKdkD9PgMrJnwl6Smx/zXs/7kY/8A7CM/8mkpX/Nez/uRj/8AsIz/AMmkpX/Nez/uRj/+ wlf/AJJJTodOwMzBit+UyyhoIbSyltQBJmZa4pKbGT/PYn/HH/z1ckpjgsZZ07GbY0Oaaa9HCR9E JKZX111UhtbQwerUYaABPqM8ElPL9axLcivruDj1m+y0MfXU1/pF7rGtMCz836KSnlBhWu6hdSKA bcbKwje37cf0eyt28vniD2/ORQ9xg5mEz9oF+RUN7GhkvaN3tdxr4lBLD6w5WXk5vSz0fNxBTXc4 5gdYC9zTtDRXtPPP4JKed6Lmdf6jXh5GP1HByK68637UWFwHpe0hrA8NJd7vxCSHWyrR9qu/QOMW PE+pk6+4/uthJSH1hMfZ3f8AbmV/5FFTrdKzum4bBa9t7L3gte2LrGATpHqBBLmNzKnNDvUIkTBz bAf+oSQv9qr/ANJ/7PP/APIJKWGVX/pP/Z1//kElKGVX/pP/AGdf/wCQSUv9qr/0n/s8/wD8gkp1 undLdl1m7IddWxwa6p1eU94cDM9gkl3QIAHhokpR0BI/JKSmr6937/8A7L2/+SSUr17v3/8A2Xt/ 8kkpXr3fv/8Asvb/AOSSUr17v3//AGXt/wDJJKV6937/AP7L2/8AkklJ6Huewl5kzH0HV/g8kpKR 5P8APYn/ABx/89XJKV0//k/G/wCJr/6kJKZ5LH2Vba4Lg5jgHGB7XNdyAfBJTy9vSPrjR1bPy+n/ ALNsx817HtblWX+oza0NI9lURISUid0X64Gx9pwegGy0g2P3ZAc8jQFx9HVJTpdG6d9YKXZ1vVhh h2YK2VsxbLXMY1jS3/C1AydySnT6mb2U+tTV6/pgksa4h54jaGsdKSnE6bh497zjVdEbhsbNv6Rg rZuJbMfoD7jz8klNu7ovUbLn2MvrDXOLgC/I0BP8m4BJSbF6G8B3261zjps9G25vxnfa5JTrNaGt DRwBAnU6JKeYyc36v5FxtZ1B9AMfo66TtEDzpKSlY2Z9X6Lm2v6i+5rZmuyk7TII1ikJKb37d+rH 79f/AGy//wBJpKV+3fqx+/X/ANsv/wDSaSlft36sfv1/9sv/APSaSkjfrN0FoDW5AAGgArsAH/QS UmxevdJzb242NfvtfO1ux4mAXHVzQOAkpsZebiYTA7KtFIfo0u8fxSU0v2z0v/yy/wCo/wDSSSlf tnpf/ll/1H/pJJSv2z0v/wAsv+o/9JJKV+2el/8All/1H/pJJSv2z0v/AMsv+o/9JJKbmFlY+XW5 +Nf9oa10F2mhjj2takpfJ/nsT/jj/wCerklK6f8A8n43/E1/9SElNhJTC26mhu+57a2kwC8honw1 SUi/aGB/3Jp/7cb/AHpKTMeyxofW4Oa7UOaZB+YSUySUpJSklKSUpJTyeW+yi810ZNuQwRFjb8do MjwLUkIftGX+/d/7EY//AJFJTpVY2O+pj7Oqure5oLmGyklpI1bIb2SSz+x4n/lw7/Pq/wDIpKV9 jxP/AC4d/n1f+RSU2sM9PxWubZnV5JcZBtfXI8hthJTdpsxLpdjurft5NZaYn+qkpz/rB6vo1ek1 7juM7Ka7u3hbwkpw5y/9Hd/7BY6SFTl9q7v/AGCx0lKnL7V3f+wWOkp06+j2WVtsObUzc0O2uxce RImD7UkpB0DIIkZlZB7/AGSj/wAikpu9O6fkYLnepkC1jh9BtNdQDv3v0YCSk2T/AD2J/wAcf/PV ySldP/5Pxv8Aia/+pCSmPUDm+hswa9736F28VlvmNzHgpKca/p/XMlgryWG5oO4NstpcJ8YdinxS U1mdHzLHPazGrJqdseN1GhLWvj+ieDgkpt1Yn1gpa2uoOYxnDG3VBoHhAxklO7jvufU12RWKrDO5 gdvA1090N7JKSJKUkpSSlJKeY6pjCnNfXjYjhWA2PS6fXc3Uaw8ubKSmp6V3/cS7/wBxVX/pRJSv Su/7iXf+4qr/ANKJKV6V3/cS7/3FVf8ApRJSvSu/7iXf+4qr/wBKJKV6V3/cS7/3FVf+lElOr0Bu SL3gtsprDZcx+GzGDzwPcx5mElNrrxwxjAZVXquM+l7HWBro5IbCSnm4p/0FP/sLb/5NFCop/wBB T/7C2/8Ak0lOkLPqzAnAsnv+heglt4OB9X+oNeacLaGQD6jHMOvhJ8klOvVVXTW2mpoaxgDWtHAA SUzSU18n+exP+OP/AJ6uSUrp/wDyfjf8TX/1ISUg643f0q9slshurefpN4SU+ZU5Ftk5VV1tuPJ9 zXPOvh4cooZX29RYxrjXkVi9pO6XfSHtEa66iElOl9VsvJq6i7Hyw91mRRa6tryZYKRJth3HugAo KD3nUuoV4GM63c31BBbWdXOE67WyCdJSS5fTfrLbmsvsdWxwobMMcACSWfnvdH535ElN/p/VnZ1x q9D0wGlxd6lb/DsxxKSnRSUpJTx/U8zAzcx+QxmO9rg0B11WRv0Ea7CAkpqzh/6LD/7ayv8AySSF Thf6LD/7ayv/ACSSlThf6LD/AO2sr/ySSm/ju+q3ot+1UA3fn+my4N57btUkpN31P/0Dv8y1JTrY PWOm5D2YeIXyGwxpY5oAaPFw8AkpH1/LsxKanV5jcIucQXOrNm7TiAx8JKcX9tZX/l5X/wCwx/8A SKSlftrK/wDLyv8A9hj/AOkUlK/bWV/5eV/+wx/9IpKbGFl9V6jaaMPrFdj2tLyPs+32ggT7qh4p KdPCxOu1ZLH5ucy6gTvrFbWk6GNQ0d0lOokpr5P89if8cf8Az1ckpXT/APk/G/4mv/qQkpF1k7em 3O8A0/c5qSny3omVf0/6ljKqYHNOVa5+7WAXaaJBRXq+sYfSy8PYDdZsrpgPsER9Nu0D3ToZCKHb pY531tqZdLbbOl5BL2Etc0NsDvT0MRrqgl7LOxMbG6fcaKw0wHOc2S8gOaT7hLuySnG6Jim5t+I1 8FzCd1tTnMEuYf5u72njxSU6eL0bMxLRZVlUsEjeK8SusubMlu5rklOukpSSnnOv3srzg1z9p9Np j7S6nufzWtKSnN+1VnT1f/Z1/wD5BJCvtVfHq/8As6//AMgkpX2qv/S/+zr/APyCSklDzkWtpocX 2PPtaM18nT+p5JKbremdVY4OFDyWkGDmvI0/spJdvDszrA77bSygiNoY/fPj2CSml9YLLa6ajUXg lxnZZXX28bQUlOH9oy/37v8A2Ix//IpIUcnK7vuH/oTj/wDkUlKOTlfv3f8AsTj/APkUlOpTj0bG vPV31vc0FzfUpkE8iQ1JKT0KToOt2f8AblX9ySm/h4V2K9z7Mu7IBEbbdsDzG1oSUzyf57E/44/+ erklIaaLMjpOPVVc7HcaqosZEiGt8UlNXqNFmF0PLGRkPyDG/wBSyJAlumnwSU+ZU7B9RMdw43vd vn6Mlw47ykguNjYeba3GvrY+yl25jS1ugj6TJ855RQA95jvrZ9Y6Mt4dXWzp2RXqCYc704ZMeSC5 7LK6xi10Odj2NfZoGtLXakkCOySmlh/WC++q259I21D6I/Rkncxv0rCBpuSU2cTrlWRYWXsbjNDZ D33VuBMjT2uKSnTa4OAc0ggiQRqCCkpdJTgO+sL3GXYLCfE5FJSUt+3z/wBwK/8A2IpSU6oy+lkA m3HBI1G9n96Slfa+l/6bH/zmf3pKXGZ0xpkX0A+Iez+9JTL9oYH/AHJp/wC3G/3pKZV5mHa8V1X1 veeGte0kxrwCkpq9ZxH5ONvZtPoy/aaG5DnacMa8jVJTzvpXf9xLv/cVV/6USUlxcO7KvbR6Lqd8 /pLumVNYIBOrt58ElOh/zcu/0+L/AOwNX96Slf8ANy7/AE+L/wCwNX96Sm5h9FxaKyMqrHyLN0h4 x664EDSBKSnRSU18n+exP+OP/nq5JSun/wDJ+N/xNf8A1ISUi6xR9q6ddjTHrba58Nzmt/ikp866 V9Xshv1epwOo0WtNNljIBDSIcfHSHBJRUPqt00ubVXS/cCWsay9jjWD9IAR3RRTt4PRsgdar6g5h ZTjdPyGa6w95DAyfJrEEvVdYBd029oDzIA/RTv8ApDVsA6pKed6B0p3o5GC0Oq9RgO6ygiv2mr/B vME+3x8PBJTf/wCa9n/cjH/9hGf+TSU6+Bj34uOKb7heW6MLaxUGsAADdrSeISU2UlPMdUxhTmvr xsRwrAbHpdPrubqNYeXNlJTU9K7/ALiXf+4qr/0okpXpXf8AcS7/ANxVX/pRJSvSu/7iXf8AuKq/ 9KJKV6V3/cS7/wBxVX/pRJTodM6S7Ki+5lddbHw6m/Aqqc4CDp7naGeUlO1V0/AosFtGNTW9vD2V ta4TpoQElNPrv2z0qvsb8it247jjVi0kR+cC9kJKcb/Lf+n6l/7DN/8AS6Slf5b/ANP1L/2Gb/6X SUr/AC3/AKfqX/sM3/0ukpX+W/8AT9S/9hm/+l0lLtHW3ODftPUWyQJOM2BPj+nSU9Uxrmsa1ztx AALvEjukpDk/z2J/xx/89XJKV0//AJPxv+Jr/wCpCSkttTLmenZO2QdCWmWkOGrSDyElInYOO8EP 3uB0INlh/wC/pKQV9D6VVYLqqAywcPa5wI+e5JTY+xUFpafULToQbLIM/wBtJSdJSklKSUpJSklP IdUxunYWa/HqoxmtaGkCxmQ52onmt21JTUnC/wBFh/8AbWV/5JJDp1fV+6+pl1ePgFljQ9sjIBhw kaGxJLL/AJtZP/cfp/8A4P8A+lElK/5tZP8A3H6f/wCD/wDpRJSfD+rjW3bs3HxPTAkej6odu7fT eQkp3klON9ZWNfRSHNY6Hn+cZY8cdvS1SU896FP+ix/+2clJCvQp/wBFj/8AbOSkpXoU/wCix/8A tnJSUr0Kf9Fj/wDbOSkpu4vQrsyr1qasPaSR7m3tOnk5wSS9VTTXRUymlu2usBrW+ACSkWT/AD2J /wAcf/PVySldP/5Pxv8Aia/+pCSkz7GVNL7HBjRy5xgCdOSkpF9tw/8AT1f57f70lK+24f8Ap6v8 9v8Aekpf7bh/6er/AD2/3pKV9sw/9PV/nt/vSUr7bh/6er/Pb/ekpdmVjWODK7WOceGtcCT34lJS VJSklKSUpJSklKSUpJSklKSU5H1ieGU0n1G1e46utfVOniwGUlOF6w/7lV/+xd3/AJFJCvWH/cqv /wBi7v8AyKSlesP+5Vf/ALF3f+RSU3sV/RvSY7K6g9t2pc1mRY5vOnMdkkut+3+jf9y6/vP9ySmx i5+HnBxxLW2hkB23tPCSlZP89if8cf8Az1ckpXT/APk/G/4mv/qQkpfLE1Af8JV/58YkpKGgJKYZ Fzcel1zho2J+BMJKeXyvrF1DL6nZg4RaMel2x1lLg5zi4NczV3i2eOO6SGx0nP6tT1N+Jk1MbhPI bXbbdvte87iSxs/QEhvGpSU9IHNOgIMeCSUV/wDO4/8Axh/892JKTJKUkpSSlJKUkpSSlJKUkpSS nJ+sHq+jV6TntO4zsurp7eNvKSnDjL/0l3/sbjpIVGX/AKS7/wBjcdJTYHT+snUVZn/sTT/cklX7 O61/osz/ANiaf7klMqum9XNrA+vLa0uG5xyKSAJ1MAJKemaxrfogCfAQkpDk/wA9if8AHH/z1ckp XT/+T8b/AImv/qQkpWfZXTjG21wZXW+tz3uIDWtD2kkk8AJKeZ6j/jR+qmETVi3WdSv1Aqw2F8n+ u7a37iUlOJX/AIwevdS6xjdJzOkjAweqF1NLrd/rTt0cD7W8kabfmki3k+idZ6h0fod9mL7fs2ZS 3ItLWueapsYWs3z9JwH3IoT9Lyrbet9PuyW25AGQ6pj7Xl1rw54s9IHXa5pIiAOeUlPpv1ZtaMOy +1jIqtcDaP5wTzuEcILnRr6ngZ19DMS5trm2EuDZ0Hp2eISU6CSmpk9QrxK77ra3+ljCbHjbGjQ/ QF4J+l4JKc4fWiRP7LzwDqCRQNPMHJBHzSUyZ9Zq3OaLMDLpYXBpsf6G1pcdo3bMhxAk8xCSnUZk F1oqfU+suaXAu2kQ0tB+i937ySmtmdWrw6xY7HusDrfQYK9hLnyW6brG/unUwkprP+slbAXHCyCG 6na/GP4DKlJS2P8AWanJgV4WWHEwGltcz8rikq27gdUo6hZdVU17H4+31Gv2yNxcAPY537hSU1fr BVbbTUKmPeQ4zsx68nt+7aRCSnD+x5f+hu/9xmP/AOTSU3+m9FtvLb7yxtbHw6m/Borc8CDoWl2h nlJT0QAAgaAJKXSUpJSklNfJ/nsT/jj/AOerklIqK77elY7Me449hpriwND49rfzXaJKcn6x9J6r l/VzqGD9qGZdksYylj2Nrbu3t9pLI+lwkp8rx+r21bqunUUdFYw7HtqrNuQHN9rxut+jrKK1q05N 2P8AWHA6jdddb6WVVY197y86Pbu10A+ACSrT5VHot6/hAO3YuU99QH5pZdo4+TW2EpKZ0it2ZTl+ u+2z122HKb7fUB1LxuLDvmSNUlPr/Suluw7LrGhltOXZ6wfqywMPuaxzSDMH4ILnQtrrZbjljWtJ sPAA/wAHYkpsJKcH6zlw6H1LaYJtpbI/lHHB/Kkp5L65NbkA4IpymChjcr1sP0279zvS9M7/AA3b kUNjpdjXYVuKKbKvshGMH3bS+0VljvU9vjCSg967+mVf8XZ/1VSCXC6yXG7plX5pzMl5+LBcQkp5 Hrdn23rTbPTuosxLnYjX0ZddQe1rTfuczU+46R4Iod/oeS/Ou6V1SxnpPuLprDxY1oex7YDm6FBQ elxsSvH6ll3V6faGUvcP5QNoJ+aSWn9ZWNfRSHNY6Hn+cZY8cdvS1SU896FP+ix/+2clJCTHpwhc w5NNJqn3hlOSHR5Skp0dn1U/7i2f9t3JJbOH0z6uZ+/7Pin9HG7eLGfSmI3EeCSmz/zc6J/3Fb/n O/8AJJKZN+r3RmOD24zQ5pBB3O5H9pJTZyf57E/44/8Anq5JSun/APJ+N/xNf/UhJTLK/mm/8ZV/ 58Ykp4L/ABifVInf9YemsEjXNraOf+GA/wCr+/xRQQ+ev221Gt3I1HiHDUFJa7d9Tc36x9RxHvLG 9TxmZD7QOPUqrsfPx2FJLvYNGP0n3UspeC07si8RWGVgM3trEtlsjVrd2vmkl2umfXLqRpac2iu/ T6VZNbvmDuCVKt2MT6wYXU8rGx622VXF5dssboYrsmHNLgglvZeN1K23diZox64A2GltmvjuLgkp pddr9XpHU2+Dmv8A8xtL/wCCSnhfrqzGd1DIfYKST02tx9Si207Rezl1ZDY8uUkM+h341TOoubsO 7KcS2mt7ST7ed/Px4RUHteldd/a3URW3GfQ2umxwdYRJ99Q4CCVuqtHp4Vp/Nzns/wC3HWsSU8V1 DEeetZMVPM9QeZGCHTNDuLJ939ZJDv8A1Tp24XR63NLdrHOh1XoEQ1/+CE7Ukh6xv9Mt/wCLr/6q 1JTnfWJ4ZTSfUbV7jq619U6eLAZSU4XrD/uVX/7F3f8AkUkK9Yf9yq//AGLu/wDIpKV6w/7lV/8A sXd/5FJSbE6g7Dt9WvIoeYLYsybXjXyLElNz/nJkfv4P/br/APyCSU+L1fqea5zMRuHaWiXBtj9B /mJKdPJ/nsT/AI4/+erklK6f/wAn43/E1/8AUhJS+YQ2kOcYAsqJJ4H6RiSl3ZGG9pa62twIggua QQfmkp8j+vH1Sf07MOR0MG3Hvl9bKveayPpVO29v3T8kVpDtfUf9ldQ6dj1dawfS6rhn23XVWML2 MGxk2aNPtJBaTCCQ6vXOkm7pVmH019Zf7/TFjxPvd6jmhx4E9klFwMT7ZRWKLqHh7Pa7QuHyc2Qi p2vq9vPWsQurc2DZqWkD+bsSU9wglwfrNk3Y/Q+rnFh2QG7mVgBznDZVuDWnmRKSnj8j68YeXiNx rOkdXraC181NDXBzDu0Pgkhiz61Y+VYzFwuldRpyL7GVstvqaKmbntDnP8g2UVPoONj4VWa12Jt/ mrA7a7cB7qvMoJcH649Su6Z0vHy8ap+U7H6hvuxqvpur3XaxtceY7JKeZzvrvj9Rsxbsv6udQc/C sNuORYW7XERw2sfikh1Pq39an9W65iYrenZeBTULrbrst24EFhDW7nMb+cfFJL29NjLMq11bg8en WJaZEzb4JKanW827DqqdS7GaXOIP2rdHH5u1JTkft3N/0nS//BElOu3rXQ4G7IpmNYHf7klK/bXQ f+5FP3f7ElK/bXQf+5FP3f7ElK/bXQf+5FP3f7ElN+h1FlbbqNpZYAWuaOQUlI8n+exP+OP/AJ6u SUrp/wDyfjf8TX/1ISU2ElKSUpJSklKSUpJSklKSUpJTWzOnYfUNn2thf6c7Yc5kbon6Dm+CSmeL iUYVXoYzSxgJMFxdqfNxJSUmSUpJTTzulYfUHtfktcSwQNr3N0P9UhJSbFxqsOhuNQCK2TtBJcdS Xcn4pKTJKc/rN76cbYxgebZbu9VlRZp9Jpt0lJTzsZf+ku/9jcdJCoy/9Jd/7G46SlRl/wCku/8A Y3HSUqMv/SXf+xuOkps9P+3tyBZXVbl7QZqdlUPbB0khqSXoMK7KuY77TjHFLTDW72vkf2ElL5P8 9if8cf8Az1ckpXT/APk/G/4mv/qQkpsJKYW3VUsNlz21sHLnkNA+ZSUqu2q1u+p7XtPBaQR+CSma SlJKUkpHZfTT/O2Nr/rOA/KkpjXmYltno1XVvsILtrXAmBpOnxSUmSUitysahwbdbXW4iQHuDTHz KSkgIIkag8FJSz3sraXvcGtaJLiYAHmUlIGdS6da0PryqHtPDm2NIPzBSUyx87Cyn2V4uRVc+kxY 2t7XlhOsODSYSUnSUpJTXzcOrNpNVjWF0HY97G2bCfzg14ISU5X/ADaf/wByKf8A2Dx//IJKV/za f/3Ip/8AYPH/APIJKV/zaf8A9yKf/YPH/wDIJKdGvpHTWsa1+LjvcAA53osEkcmA1JSWjCw8Zxfj UVUuIgmtjWkjw9oCSk6Smvk/z2J/xx/89XJKV0//AJPxv+Jr/wCpCSmeTlY2HScjMurx6mwHWWuD GiTAlziBykp4L6+3dJy/12+tnVKamtbXXU9zyJ1Lmip0d+UlPOfV7o/1a63mU41VGV077TvDH1Xu Ba4Ax7HDxSU9l/i76pePq1kDOfbkOwMqzHHNlmwbA0d3HUn5JKejq61jW2NrFOQ0uIG59TmtE+JP CSnQSU+d/WHK+sNnWMh/Ts52JjVh3qDeWDc19lY0A1JDAig2x6Db9Ycu/Fz7M9+Vj7qhZTZZ7WXF 1ftLoc4GHRwkoPc23dRa0bqqaw5zWb2Wue5u9wbIa6hoMT4oJc7M64/pPXMLo7en2HGznFv21sbB YRPunUnTUlJTqgMour9GBXe4tLW8btrn7h/mmUlOd9bL76OlPOM/0rdSywQdpDTB18CUlPJW9P8A rJjvroP1jbl2t3eq2usFxAG7WXiNPBFTqdFPVen57a+p3WZpD91ZFYY5rXtsBrDZkjRvzCSHoret 49NnpPoyS6Gn21OP0gHRp311QSvV1rGtsbWKchpcQNz6nNaJ8SeElOgkpSSlJKUkpSSlJKUkpr5P 89if8cf/AD1ckphh+p+y6PR2+p9nZs3zt3bBG6NYlJTzf136T1frP1Yy6cplD3UFmRWylzxu9Mnf uLgPzTKSnx2zpmVj+8UW1AfnVOa5v3jaUlPQ/VDIsp+sfSqHkkG2trnFxducXSXe748JKew+qFbG 4P1jocHGtnUSB6dYtdo5vDHSCkp1sT9l0bvtGFkZO6Nu7DYzbEz9ADlJT1Fb/UY18Fu4A7XCCJ7E eKSnkuoYmLfn5eFeSH5Ieaw3R+9psfLO0tBSQt0HEowej4dBBGZe7EyMttk7y6y1gl3zaQB5JKD1 mRW62otaYcC1zZ43MIcJ8pGqSXJ67jO6njVV03HBy8e1t1JtYXNLwCNumj5DvzSkpP0jAOJh4uNu e+vEaYstBa+yx27c/a7UAbjE+PkJSnJ/xiuc36t5RaSD6Fuo/qpKfJPqs/Nb1nDdTkF7anMyra23 OO9rSHFsfvaQUlPp3Qss5nVK3e5pba3cxwALXOF73DTtroUUN3rVtjeqXNbgU3j2fpH0WWOPsby5 rgCglqtdkuEt6TQR4jDtP/fklPYUmw0sN0eoWjftkDdGsTrEpKZpKUkpSSlJKUkpSSmvk/z2J/xx /wDPVySldP8A+T8b/ia/+pCSk5AcC0iQdCCkp8q+tXR3dD6i+oMccS4Gyl4EgNP0qz5t/Ikp5WrI d03Ppyaj78S2u+o+QcHD+5JT6L9UqzZ9XurdTvrsqo6jnOyKQKxY4sL2QQx8giUlNmqnp9tjKpuZ vcG7n4dIaJMS47dAkh66hr20sa+z1nRrYQBu84bokl4T6w/85sPrV1mE+yvHssL/ALV6RsaW7Wht IZWHP9pBMkaooKDpXUfrVe/Ep6lZYyr7fjH7VbWGttYHNa6prXND9zy7nThJT6Mgl5XqLrq+q2X1 4bXvrsDm2EZJktiDDPZ2SU63Sc3qma5z8ququlst0FjX7tI0saNElOb/AIwWB/1evYXBvqMsqDnc bnscGzAKSnxzo/VW9KZdaKbLbS1lLHl7drQDD3ta7aZPZJT6B9QOpYed1CltLwbbCbywnc9rRW9s O/zx96Kne60+OrXD7PVZ9D3Pp3k+xvLt4lJTLEzeq01lmFQ1tcyRVjOiT8LEFOv03qGVbtpzKLha 4mbPSNdYAEiZc5JTpJKUkpSSlJKUkpSSmvk/z2J/xx/89XJKV0//AJPxv+Jr/wCpCSmwkpi9jLGl j2hzXctcJBSU5OZ9UPqzn2i7K6dQ540lo2T8QwtBSU3svAqycF2AyKayGtaGtaQ0MIIAaRtj2pKc n/mlT/3I/wDAav8AyKSnVwMK/DBbZkvyGQGsa5rWhoHhtASU+AfWO9+X9YOt3se4A5luzUj2iywD /qQitKP6nXvb9a+kPte5zfttI1l2rnho/Kgl+jkkvJdUf1QdQvFNmQK9/tDHZAbHlsYW/ckp1Ohd QuNbMLLZcbdzttjm2EFsbvfZa0a8/gkp1bqKshobc0PDXBwB7ObqD8Qkp47O/wAXbsrqQy68jE9I ua53rYVb7tDrtsDmDjj2pKel6b0TB6aW2U1tN4r9I3BrWktndEMAA18ElNi3p+BfYbb8amx7uXvr a5xjTUkJKZ0Y2PjNLMaplLSZIraGgnx9oCSkqSlJKUkpSSlJKUkpSSmvk/z2J/xx/wDPVySldP8A +T8b/ia/+pCSmwkpSSlJKUkpSSlJKeA6l/imxsvqGZm4mf6DM2w3Ppsp9Xa5xLztcLa9JcY0SQQt 0H/FPR0jq+P1PIzxksxXi1lDaPTl7dWuLja/gwUlU+gJJeY6j+0vt13o/atm727PtO2PL0/b9ySn c6V6n2Cn1fU3wd3q7t87jz6nu+EpKbaSlJKUkpSSlJKUkpSSlJKUkpSSlJKUkpr5P89if8cf/PVy SldP/wCT8b/ia/8AqQkpsJKUkpSSlJKUkpSSlJKUkpSSlJKUkpSSlJKUkpSSlJKUkpSSlJKUkpSS lJKUkpr5P89if8cf/PVySmv0/qGAMDGByaQRTXI9Rv7o80lNj9odP/7k0/8Abjf70lK/aHT/APuT T/243+9JSv2h0/8A7k0/9uN/vSUr9odP/wC5NP8A243+9JSv2h0//uTT/wBuN/vSUr9odP8A+5NP /bjf70lK/aHT/wDuTT/243+9JSv2h0//ALk0/wDbjf70lK/aHT/+5NP/AG43+9JSv2h0/wD7k0/9 uN/vSUr9odP/AO5NP/bjf70lK/aHT/8AuTT/ANuN/vSUr9odP/7k0/8Abjf70lK/aHT/APuTT/24 3+9JSv2h0/8A7k0/9uN/vSUr9odP/wC5NP8A243+9JSv2h0//uTT/wBuN/vSUr9odP8A+5NP/bjf 70lK/aHT/wDuTT/243+9JSv2h0//ALk0/wDbjf70lK/aHT/+5NP/AG43+9JSv2h0/wD7k0/9uN/v SUr9odP/AO5NP/bjf70lNfJ6hgG7FjJp0uM/pG/6K3zSU//Z 2 JPEG 256 256 /9j/4AAQSkZJRgABAgEASABIAAD/7QAsUGhvdG9zaG9wIDMuMAA4QklNA+0AAAAAABAASAAAAAEA AQBIAAAAAQAB/+4AE0Fkb2JlAGSAAAAAAQUAAgAD/9sAhAAMCAgICAgMCAgMEAsLCxAUDg0NDhQY EhMTExIYFBIUFBQUEhQUGx4eHhsUJCcnJyckMjU1NTI7Ozs7Ozs7Ozs7AQ0LCxAOECIYGCIyKCEo MjsyMjIyOzs7Ozs7Ozs7Ozs7Ozs7OztAQEBAQDtAQEBAQEBAQEBAQEBAQEBAQEBAQED/wAARCAEA AMYDAREAAhEBAxEB/8QBQgAAAQUBAQEBAQEAAAAAAAAAAwABAgQFBgcICQoLAQABBQEBAQEBAQAA AAAAAAABAAIDBAUGBwgJCgsQAAEEAQMCBAIFBwYIBQMMMwEAAhEDBCESMQVBUWETInGBMgYUkaGx QiMkFVLBYjM0coLRQwclklPw4fFjczUWorKDJkSTVGRFwqN0NhfSVeJl8rOEw9N14/NGJ5SkhbSV xNTk9KW1xdXl9VZmdoaWprbG1ub2N0dXZ3eHl6e3x9fn9xEAAgIBAgQEAwQFBgcHBgI7AQACEQMh MRIEQVFhcSITBTKBkRShsUIjwVLR8DMkYuFygpJDUxVjczTxJQYWorKDByY1wtJEk1SjF2RFVTZ0 ZeLys4TD03Xj80aUpIW0lcTU5PSltcXV5fVWZnaGlqa2xtbm9ic3R1dnd4eXp7fH1+f3/9oADAMB AAIRAxEAPwD0Xp/T8A4GMTjUkmmuT6bf3R5JKbH7P6f/ANxqf+22/wBySlfs/p//AHGp/wC22/3J KV+z+n/9xqf+22/3JKV+z+n/APcan/ttv9ySlfs/p/8A3Gp/7bb/AHJKV+z+n/8Acan/ALbb/ckp X7P6f/3Gp/7bb/ckpX7P6f8A9xqf+22/3JKV+z+n/wDcan/ttv8AckpX7P6f/wBxqf8Attv9ySlf s/p//can/ttv9ySlfs/p/wD3Gp/7bb/ckpX7P6f/ANxqf+22/wBySlfs/p//AHGp/wC22/3JKV+z +n/9xqf+22/3JKV+z+n/APcan/ttv9ySlfs/p/8A3Gp/7bb/AHJKV+z+n/8Acan/ALbb/ckpX7P6 f/3Gp/7bb/ckpX7P6f8A9xqf+22/3JKV+z+n/wDcan/ttv8AckpX7P6f/wBxqf8Attv9ySlfs/p/ /can/ttv9ySmvk9PwBdixjU63Gf0bf8ARW+SSmx0/wD5Pxv+Jr/6kJKbCSlJKUkpSSlJKUkpSSlJ KUkpSSlJKUkpSSlJKUkpSSlJKUkpSSlJKUkpSSlJKa+T/PYn/HH/AM9XJKV0/wD5Pxv+Jr/6kJKb CSlJKUkpSSlJKUkpSSlJKUkpSSlJKUkpSSlJKUkpSSlJKUkpSSlJKUkpSSlJKa+T/PYn/HH/AM9X JKV0/wD5Pxv+Jr/6kJKQ9V6VV1VlbLLX1CslwNZAJnxkFJTm/wDM/F/7lZH3j/yKSlf8z8X/ALlZ H3j/AMikpX/M/F/7lZH3j/yKSmxgfVvHwMuvLZkXWOrmGvILTuBbrp5pKdhJSklKSU8jnY+7NyD9 m6o6bXndUfYfcdWfoj7fBJSH7N/3V6v9/wD6iSUr7N/3V6v9/wD6iSU3em9Gqz/U9X9pYnp7Y9Z4 bu3TxNY4hJTd/wCauL/3LzP+3B/5BJS7Pqxi1va8ZWWS0gwbBBjx9iSnZSU431irv2V5FftqqB9R 3rOpA3FoH0eUlOD9pP8Ap2/+xliKEuN1KzFuFzLanlsiLMp726iOCElN3/nPleGH/wBun+5BKv8A nPleGH/26f7klK/5z5Xhh/8Abp/uSU6HSOsHqFllNxpDwA5jaXl5I13TI7aJKdVJTXyf57E/44/+ erklK6f/AMn43/E1/wDUhJTR+sNJuqpArybYcdMQhpGn50tckpw/sTv+4vVf89v/AKTSUr7E7/uL 1X/Pb/6TSUr7E7/uL1X/AD2/+k0lK+xO/wC4vVf89v8A6TSU3unZOR01tjasDPt9Qgn1iHRE8Q0e KSnX6fn35peLsS3F2AEG0RunwSU3UlPH51dBzcgmjGcfVfJdVlEn3Hksdt+5JSD08f8A7j4v/bOX /wCSSQr08f8A7j4v/bOX/wCSSUr08f8A7j4v/bOX/wCSSUr08f8A7j4v/bOX/wCSSUyqx6brGVMx 8Tc9wa2asoCSY1Jckp6nE6T07AsN2JSKnubsLgSdCQY1J8EksesXBmE+trw218bGixlbjDmztNvt 4SU896mb+/Z/7F4v9ySFepm/v2f+xeL/AHJKbGGw3lwy81+KGxtJvx7N3+YEktr7Hif+XDv8+r/y KSlfY8T/AMuHf59X/kUlMq8fFreHjrDtDMepVr5fRSU7LHssaH1uDmu1DmmQfmElIcn+exP+OP8A 56uSUrp//J+N/wATX/1ISU5v1mrrspoFhaAHGN1wp7eJa6UlPP8A2fF/fr/9jR/6TSQr7Pi/v1/+ xo/9JpKV9nxf3q//AGNb/wCk0lOvR163HoroYMQtqYGNJygTDRGvsSSz/wCcmR+7h/8AsSP/ACKS m/hZvUsp1djsekY75m2u7foJ4G0Tqkp0UlPH52QW5uQ31miLXiPtVjY9x/NHHwSQg+0n/Tt/9jLE VNvHwup5dQvxgbK3SA5uXZGmiCkv7J61/o3f+xb0kq/ZPWv9G7/2Lekpu9Iw+qYuVuyK4qc0hxde 62O4hrvNJTtJKc/rWMy/Ce8VCy5kem4UsveJc3dtZZA480lPO/Y8v/Q3f+4zH/8AJpKV9jy/9Dd/ 7jMf/wAmkpX2PL/0N3/uMx//ACaSlfY8v/Q3f+4zH/8AJpKbuN0DJyaRcbq6Zn2W4FDXCPECUlJf +bOR/wBysf8A9gaElOvgY1uJjNx7rRcWkw5tbagB2AYzRJS+T/PYn/HH/wA9XJKV0/8A5Pxv+Jr/ AOpCSkHV8KzLxwanva6qXBrA0l5j6Pv0SU4P7P6r/osr/wAASQr9n9V/0WV/4AkpX7P6r/ocr/wB JSv2f1X/AEOV/wCAJKdCn6v32VMe/Ltrc4AlhZWS0+GgSS6HT8C3B3CzJfkNIAa14ADYnjakpupK eZ6q59GW4UZFlocXOcG3UMDCXH2Q9s6JKaf2jL/fu/8AYjH/APIpIZDMzmiG23geAycf/wAikps4 V1+TY5uTnXYrQJDnZFDpM8e1qSW76NP/AJd2f9u1f3JKV6NP/l3Z/wBu1f3JKdHHysQtroZksueG hs72lziBzp3SUg6vd1DGqGRiPqZWz+c9Rj3ukkBu0V/FJTkftzqv+lp/9h7/APyKSkuL1LrWZb6N NuPuIJ91NzRp5uASU3fT+s3+mw/816Slen9Zv9Nh/wCa9JSbEZ1sXg5tmO6nXcKmuDuNIlJTfSUp JTXyf57E/wCOP/nq5JSun/8AJ+N/xNf/AFISU0uv2U11VG7IycYFxg4sydPzoSU4v2nB/wDLLqn3 uSUr7Tg/+WXVPvckpX2nB/8ALLqn3uSUr7TgS1v7T6nLiGjVw1KSnocDpr8F73uy8jJ3iIvfuA8w kpvJKUkp5nquFdRlucKzeLi6wGnp9d23cTo55eCSkpp+ld/3Eu/9xVX/AKUSUr0rv+4l3/uKq/8A SiSleld/3Eu/9xVX/pRJTbwelXZweYbj7IEZHTqmEz+77ykptf8ANy7/AE+L/wCwNX96Sm90/pNO GN1raLbg4llrKGUloIiBtnzSUrq2DZl076C83V6MY211TTJE7i3ySU437K61/o3f+xb0lL/snrX+ jd/7FvSUr9k9a/0bv/Yt6Slj0rrXat3/ALFvSUv+yetf6N3/ALFvSUu3pfWmODhUSWkGDlvI0SU9 JWXmtptAa8gbgNQDGsJKQ5P89if8cf8Az1ckpXT/APk/G/4mv/qQkpq9bNLcYOsyX47xJrDLvQ3u j6Jckp537Xf/ANyLP/ciP7kkK+13/wDciz/3Ij+5JSvtd/8A3Is/9yI/uSUr7Xf/ANyLP/ciP7kl NvBsxLWOOd1K7HcD7Q3N3yPkkl1enY+G+718TqGRlel9JrrzYz3Aj3NSU6iSnlOqs6ccyw4+PUXb nesbqshxNm47iDWQISU0/Tx/+4+L/wBs5f8A5JJDOmvC9Vnr42P6Ujfspyt0d9suiUlO7jdE6BlU tvqxfY+Y3b2nQkcOIPZJKT/m50T/ALit/wA53/kklM6ugdIpsZdVjNa+twe10u0LTIP0klOgkpha JrIhzvJh2u57Hc38qSmvs/4HI/7d/wDUySlbP+ByP+3f/UySlbP+ByP+3f8A1MkpWz/gcj/t3/1M kpWz/gcj/t3/ANTJKbNYhgEOb5OMn5mXflSUySU18n+exP8Ajj/56uSUrp//ACfjf8TX/wBSElMe otDsK523c5jHFhhpIMdt+iSnl/Vy/C7/ADcf+5FCvVy/C7/Nx/7klK9XL8Lv83H/ALklK9XL8Lv8 3H/uSUr1cvwu/wA3H/uSUlxszPota5nrlu4F1YFDQ+D9E7fFBT1dbi+tr3NLC4Alp5BI4KSXleqD Ixsyz1nisWPc+sHKe2Wlxg7Rx8EkNT7Sf9O3/wBjLEVJMfqD8e5tzLa3FmoD8qxzT21BCSm9/wA5 8rww/wDt0/3IJZ0/WHPyLW00sxH2PMNaLTJP3JKbv2j6x/8AcTH/AO3Skp1UlNHqWZZjbK24VmY2 wEuDBIERzKSmh+0Xf+Ul3/bbf/IpKV+0Xf8AlJd/223/AMikpX7Rd/5SXf8Abbf/ACKSlftF3/lJ d/223/yKSlftF3/lJd/223/yKSm907Otyi6p+FbhtYJb6ggHyCSm+kpr5P8APYn/ABx/89XJKV0/ /k/G/wCJr/6kJKV1DXBv03fo3abfUnT9zSfgkp5PZ/3W/wDZD/zNJCwbIn7N/wCyH/qRJSi2P+03 /sh/6kSUyZUXvawY4G4gScCAJ8fekp0/+bd/72H/AOww/wDJJJb+L0TBqqZ9ooosuaZNjKwwTMiB qkp0UlPKZ2Tl/bL2h90NseGgZFAAAceA5sj4FJCD7Rl/v3f+xGP/AORSUr7Rl/v3f+xGP/5FJTZ6 bkP+21farHtq13G2+hzODEhrQeUlO+MzpgMi+gEdw9n96SU9V1N7d9L22NBglhDhPhokpmkpwvrN iuubVeay6uoEPf6wpDdxaBO4GZSU4HpY/g3/ANjWf+RSQ2aOkX5Vfq4+M61kxubltIkf2ElMx0DP /wC4Vn/sU3/yCSW307B6r0y11tGCXOe3aRZktcImf3R4JKdFuZ14uaHdPrDSQCRc0wJ1PCSnUSUp JTXyf57E/wCOP/nq5JSun/8AJ+N/xNf/AFISUj6nh42XjOdkt3ei1z2S57QCB39MgpKeUnD/AHcX /Ozv/IpKVuw+NuL/AJ2d/wCRSUqcP93F/wA7O/8AIpKUTidm4v8AnZ3/AJFJSpw/3cX/ADs7/wAi kpt9LzsfCyg9px2MfDHlgy3uie3qsLUlPWJKeZ6rhXUZbnCs3i4usBp6fXdt3E6OeXgkpKafpXf9 xLv/AHFVf+lElK9K7/uJd/7iqv8A0okpXpXf9xLv/cVV/wClElK9K7/uJd/7iqv/AEokpPRk9Txm GvGZl0tJ3FtfTmNE+MNtHgkp3el5tmXUW3U5FdlQaHPyKvR3kzq1u53gkpr9d+2xX9n9T04PqbPS 28jbu9ZJTjfrv/Cf+yqSGbMjqdbdrLLmN5gOxgElMvtfV/8ATZH+djf3pKdWnqXUm1Ma7p91pDQD YX1+7T6Wjo1SSy/afUf/ACsu/wA+v/ySSk+JmZd9uy/Csx2wTve5pE+HtJSU3ElNfJ/nsT/jj/56 uSUrp/8Ayfjf8TX/ANSElJMgPdRY2ud5Y4Ng7TMaQ7t8UlPOfYOvfuZX/sd/5ikp1P2G3/udnf8A b7klK/Ybf+52d/2+5JSv2G3/ALnZ3/b7klK/Ybf+52d/2+7+5JSv2G3/ALnZ3/b7klOmkp5jM/a/ 2u/0r88M9R+0Mx2uaBJja71xI8NElMsHI6ni5Atyf2hlVwR6bsdrRJ7z6xSU6X7ad/5XZ3/bTf8A 0okpX7ad/wCV2d/203/0okpX7ad/5XZ3/bTf/SiSmTesOc4N/Z+a2SBJrbAnx96SnRSU5PXSHNZQ /Moxa3g7q72NeHwQR9LwSU432PC/8sen/wDbFf8AekhX2LC/8sen/wDbFf8AekpX2PC/8sen/wDb Ff8AekpuMy72NDGdbxWtaAGgVsgAfNJKXG6g6u9j8nrONbUPpMDGtJ08ZSU6lPVOm32NppyarLHf Ra1wJKSm0kpr5P8APYn/ABx/89XJKV0//k/G/wCJr/6kJKaXX8J2XjNeG1ObRue71Q92kfmivWUl PNehT/osf/tnJSQmxbH4Vvr4raK7ACNwoyTofjKSm7+3Oq/6Wn/2Hv8A/IpJV+3Oq/6Wn/2Hv/8A IpKV+3Oq/wClp/8AYe//AMikpdnXOp7277ai2RujHvmO8e1JT0ySnl+vW4+XmDaxjjSDW43VXkyH Gdpr0hJTm+hT/osf/tnJSQr0Kf8ARY//AGzkpKV6FP8Aosf/ALZyUlOhi1/V0UNGZjF12u811Xhv JiJ14SS6GH1LoeAx1eJXbU1x3ECq0yeO4KSnWx768mlt9U7H6jcC08xwdUlOP9Yy0Po3Owxo7+mB xPb6G1p+aSnLx6H5dooxv2TZY6SGtY+dNf3EkNv9hdU/7j9L/wAx/wD5FJKv2F1T/uP0v/Mf/wCR SUr9hdU/7j9L/wAx/wD5FJSv2F1T/uP0v/Mf/wCRSU3eldJyMbJ9bMowm7R+jdjNIcHf2gOySnYS U18n+exP+OP/AJ6uSUrp/wDyfjf8TX/1ISUi6vlUY2HY22wVuta5tcuLJdH7w4SU8r9pP+nb/wCx liKFfaT/AKdv/sZYkpPh3Yj7tudlGqqD7q8qxxntogp08bF6NmWeji519r43bW3vmAkltfsHG/0+ V/2+/wDvSUnxOmU4VhtrsueS3bFtjnjUg8H4JKbiSnH6zhZ+Tex+IwuaGQYvdVrJ7NSU0P2T1r/R u/8AYt6SlfsnrX+jd/7FvSUr9k9a/wBG7/2LekpX7J61/o3f+xb0lL19J6sbGi1j2sJG4jLeSBOs JKemSU5XXsG3JrbkVkH0RBrGNXkvduLR7fVIiElOLVT1Ch4toZkVPHDmdOx2kT5ixJTqYuP17Kq9 U9Rso1I2XYlTXaeQcUlJv2d13/y3/wDZav8AvSUr9ndd/wDLf/2Wr/vSUuzp/Ww9pd1Xc0EEt+zV iR4TKSnUSUpJTXyf57E/44/+erklK6f/AMn43/E1/wDUhJTDqVlbMSzc5rXuaRXLmsJdH5rrNJSU 836mb+/Z/wCxeL/ckhXqZv79n/sXi/3JKV6mb+/Z/wCxeL/ckpdt2c0y220HxGXij+CSl/tPUv8A T3f+xmMkl1cTp+ZkY7L35+TW54ktD63ga/vNbBSU67QWtDSS4gASeT5pKXSUpJSklKSUpJSklKSU 4X1krpsfR6oYYDo3122fu/6IiPmkpxfs+J+5T/7D5P8A5JJCvs+J+5T/AOw+T/5JJSvs+L+5T/7D 5P8A5JJToVdXzaa2U1XVtZW0Ma37LfoGiAEksv231H/T1/8AsLckp1el29QyGjIyLan0PadoZW+t 24GNd58ikp0ElNfJ/nsT/jj/AOerklK6f/yfjf8AE1/9SElNfrIrdjbHYz8l7pFbmUsv9N0fS22E BJTzv2PL/wBDd/7jMf8A8mkpX2PL/wBDd/7jMf8A8mkpX2PL/wBDd/7jMf8A8mkp1fU6b/5RXf8A sLV/5JJSvU6b/wCUV3/sLV/5JJTYr6s2pgrq6ZmMY3RrW0tAA8gHpKb+LkHJpFpqspkkbLRtcI8Q CUlNezrfSarHVWZLGvYS1zTMggwQkpj+3+jf9y6/vP8AckpX7f6N/wBy6/vP9ySlft/o3/cuv7z/ AHJKV+3+jf8Acuv7z/ckpJj9X6ZlWtox8hllj52tHJgSfwCSm4kpzOt5uNRSMXJqyLG3iZxhqNpa edzYSU4frdG/0HVPvP8A6USUr1ujf6Dqn3n/ANKJKV63Rv8AQdU+8/8ApRJTq/8AOrF/7iZn/bY/ 8mkpX/OrF/7iZn/bY/8AJpKU360YrnBv2TLEmNax/wCTSU7SSmvk/wA9if8AHH/z1ckpXT/+T8b/ AImv/qQkpH1Pp9PUMcssrZZYwE1epu2hxHJ2kJKcT/mvl/6PB+67/wAkkpX/ADXy/wDR4P3Xf+SS Uzp+rFouYcirDNQI3hnqhxb3iXRKSnR/5udE/wC4rf8AOd/5JJSv+bnRP+4rf853/kklK/5t9E/7 it/znf8AkklN3FxMbCq9DFYK65J2gk6n4ykpzL6/qsb7DkHG9Yvd6m52u6fdOvikpH6X1Q8cX/OH 96Slel9UPHF/zh/ekpXpfVDxxf8AOH96Slel9UPHF/zh/ekpJjv+q2La2/HfjV2Mna4OEiRB7+BS U6eNl4uW0uxbWWhphxYZgpKcj6y7N9G+xjNHRvtfVP0f3GmUlOLNP+np/wDYq3/yCKFTT/p6f/Yq 3/yCSlTT/p6f/Yq3/wAgkpU0/wCnp/8AYq3/AMgkpU0/6en/ANirf/IJKdDo2V03Dufdk5VbXQGs Dbn2Ag/SkPaPAIJenSU18n+exP8Ajj/56uSUrp//ACfjf8TX/wBSElJn6scIJ0OjTBPwMhJTW2f8 Dkf9u/8AqZJStn/A5H/bv/qZJStn/A5H/bv/AKmSUrZ/wOR/27/6mSUrZ/wOR/27/wCpklJ6RDI2 vbrw924/fud+VJSRJTx+dbSM3IBd0yRa+fUrsL/pH6ZFZE+KSkHrU/vdJ/7at/8ASaSFG+ga7ulf 9tW/+k0lK9an97pP/bVv/pNJSvWp/e6T/wBtW/8ApNJSvXo43dK/7at/9JpKeo6NivxcU+qyhj7D u/VgWsLYG36QBlJLW6+y6K7mC0VsB3vrvroaJIA3G0FJTi+t/wALd/7kMX/yKSlet/wt3/uQxf8A yKSlet/wt3/uQxf/ACKSlet/wt3/ALkMX/yKSnQ6PmY1V1gy7QGObIdkZdFwBB4aK4ImUlO8K6XA Oa1pB1BAEEJKSJKa+T/PYn/HH/z1ckpXT/8Ak/G/4mv/AKkJKYdR6lhdOrac521lstA2l06agwCk pzf+cH1a/k/9sn/yKSlf84Pq1/J/7ZP/AJFJSv8AnB9Wv5P/AGyf/IpKV/zg+rX8n/tk/wDkUlK/ 5wfVr+T/ANsn/wAikp18V9FuOy7GAFVgD2wNuh8klJklPM9Vzbr8tzRYaBSXVgU9Qrp3bSdXMLCQ UlMMHqV2E9z94yNwiMjqNTwPMewJKbh+sl/+gxT/AOh1X9ySlf8AOO7/AEGL/wCx1X9ySlf847v9 Bi/+x1X9ySlN+sWQ4gDHxiToB9tqJk9uElOph35t2/7ZijG2xsiwWbpmeGiISU0evuvLWVs9Y1OB 9RtdFd7TBbG/1SI8klOJ6P8AwV3/ALj8X/ySSlej/wAFd/7j8X/ySSlej/wV3/uPxf8AySSmQxbS JGPeQe46djf3pKX+yW/9x8j/ANx2N/ekp0cIdYyXGoZWVjBjZBuxaWN00gQSkp26W2MqYy1/qvaA HPgN3HxgaBJSLJ/nsT/jj/56uSUrp/8Ayfjf8TX/ANSElNLr9+TRVUcaxtRLiCXVm2RHg1j4SU4v 7R6p/wByq/8A2Ff/AOkUkK/aPVP+5Vf/ALCv/wDSKSm703qwqFg6m/1i4j0/Tx3iBGs/ompJbv7b 6T+5Z/2w/wD8gkpX7b6T+5Z/2w//AMgkpNjdYwci1mPSLA52jZqe0aCeS0BJTfSU871K3oluU4fb GY1jCW2tFDXy8E7iS6s6pKan+Rv/AC0b/wCw1f8A6SSUr/I3/lo3/wBhq/8A0kkpPiX9Aot3351e Q2CNj6GgT4+2sJKbn7T+qvjj/wDbX/mCSk2Jk/V7MuFOI2h9v0gBVB076sCSnUSU5nXq734bgDX9 n09ZtjHvJ9zdsCsg8pKeb+z4n7lP/sPk/wDkkkK+z4n7lP8A7D5P/kklK+z4n7lP/sPk/wDkklO9 g09ZGJUMS7GZTt9jTVYCB8HOlJKb0vrD/wByMX/tt/8A5JJTbw25zWu+3PrsdPtNTS0AeckpKbCS mvk/z2J/xx/89XJKV0//AJPxv+Jr/wCpCSmn1+rIfjtsp+jVudY71XUw2OZbykp5z7Sf9O3/ANjL EUK+1H/Tt/8AYyxJTaxcXqGbWbcWbWA7S5uXZEgAx+KCnXbd9YmNDRiUENAEm0k6JJX+0fWP/uJj /wDbpSU6GM7IdQx2U1tdp+m1hkDXsUlJUlPH51mQM3IDbWgC18D7E1/5x/O9Mz8UlIPVyf8ASt/9 gWf+kkUK9XJ/0rf/AGBZ/wCkklK9XJ/0rf8A2BZ/6SSU3um5mJSLB1Kr7SSR6ZbiBkDvwwIJdTAz ulXZLa8TGdVYQYcafT0Ak+6ElOqkpwvrLs30b7GM0dG+19U/R/caZSU4s0/6en/2Kt/8gihU0/6e n/2Kt/8AIJKdbo/VsTDY6jJyKG1zuaRa+x0nmd7Rpogl0f2/0b/uXX95/uSUr9v9G/7l1/ef7klL s650mx7a2ZVbnOIa0CdSdB2SU30lNfJ/nsT/AI4/+erklK6f/wAn43/E1/8AUhJTU65kY2PVUcnK txGucQDUN27Tg+1ySnF+39I/8tcr/tsf+kkkK+39I/8ALXK/7bH/AKSSUyb1LpjRDer5YHkwD/0W klf9qdN/8uMz/M/9RpKdPol1GU+y3Hzr8trAGubcAAC7UEe1v7qSnXSUpJTzPXLnty4zRSzQ+l+m uYSzcYJFbYlJTnfaMT9+n/2Iyf8AyKSFfaMT9+n/ANiMn/yKSlfaMT9+n/2Iyf8AyKSlfaMT9+n/ ANiMn/yKSlDJxQQQ+mRr/SMj/wAikp6PpnXMXNLKLLavtLyYrq3kEATy5rewSSt17K9GttG0fpRP qC+qh7dpafb63ikpwvW/4W7/ANyGL/5FJTdxesDFq9I0136k77szGc7XzBCSkv8Azgb/ANxMf/2L x/8AySSmdfW33PFVODTY930WsysdxPwAckpuY9+dZc1l/TPRrP0rDZW7b/ZbqkpvelUNQxv3BJTN JTXyf57E/wCOP/nq5JSun/8AJ+N/xNf/AFISU5/1iyRjU0uOU7E3OI3NqFu7TiCRCSnD/ajP/Laz /wBhG/8Ak0kK/ajP/Laz/wBhG/8Ak0lN/p2PmdUqddidVcWsdtO7GYNYn97zSS2/2J1b/wAtP/Zd n/kklLt6P1hv0erET4UMH/fklL/srrf/AJbu/wC2G/8Ak0lOhhUZOPR6eVecqySfULQzQ9oBKSnJ +sD9uTWN72/o+GZNNA5P5twJPxSU5frf8Ld/7kMX/wAikpXrf8Ld/wC5DF/8ikpXrf8AC3f+5DF/ 8ikpXrf8Ld/7kMX/AMikpcWOcQ1tlxJ0AGfiyT/mpKem6dhDEpG59lj3Q4+s5r3MJGrQ5rWpKaH1 hqc91LhXY8NDpLMarIAkjk3H2/JJTj+j/wAFd/7j8X/ySSlej/wV3/uPxf8AySSlej/wV3/uPxf/ ACSSmVYtpeLaWZFb2/RczAxmkfAhySmyOodUBBN2cR3H2Sj/AMmkp1sfrLMi5tP2XJq3mN9jGho+ JDykp0UlNfJ/nsT/AI4/+erklK6f/wAn43/E1/8AUhJTR+sDntqp2Wvq9x1ZktxZ08XtduSU4fq3 f9y7v/crV/6TSUr1bv8AuXd/7lav/SaSlerd/wBy7v8A3K1f+k0lOi3H6YWgu65kNcQJH2xhg+Ew kpf7N0v/AMvsj/2MZ/ckpvYfSmV2V5Vefl5DB7mh92+twI8m6pKdJJTg9faLMmuGvfDIOzGpyANT oXWmR8ElOX6P/BXf+4/F/wDJJKV6P/BXf+4/F/8AJJKV6X/BXf8AuPxf70lJMfE9e5tJa+rd+fZg YrWj4mSkpvjoO0hzcygEagjEx5B/zUlOvhVZFVZGRk/ayTIfsayB4exJTT65lenU3FfhPzarhLw0 7QNpBEwPFJTisZgPe1ruhvaHEAuNjoE90lOz+wfq/wD6Cv8Az3f+SSUr9g/V/wD0Ff8Anu/8kkpX 7B+r/wDoK/8APd/5JJSv2D9X/wDQV/57v/JJKZs+r/RWltleM2QQWkOdyP7SSnSSU18n+exP+OP/ AJ6uSUrp/wDyfjf8TX/1ISU1+s4VmXjh1Ty11Uu2itlpdpwBZokp5/7Fn/6HI/8AYWj/AMkkhX2L P/0OR/7C0f8AkklK+xZ/+hyNP+6uP/5JJTYw+kZeU5zbHWYwaJBtxaQD5CJSS2x9WrhoMxv/ALDV f3JKTt6R1NjQxnVHta0QGilgACSnUra5lbWvdvc0AFx0kgcpKee69iYePcyyvHr3XF77C6p9pLpB n2OEcpKcv9B/oKdP+6tv/k0UKPoAT6FP/sLb/wCTSUt+gifQp0/7q2/+TSUvFP8AoKf/AGFt/wDJ pKVFP+gp/wDYW3/yaSnpeiU5NWO3eahjubuqZUxzCC7U7g5xQSrruNjWYTsi2plllMBhew2Ruc0H 2tIKSnmop/0FP/sLb/5NFCop/wBBT/7C2/8Ak0lKin/QU/8AsLb/AOTSU6g+rmQ4AhmFrr/NP/8A JoJX/wCbeR+5g/8AbT//ACaSnY6dj34uK2i81yww0UtLWhvYQ4lJTaSU18n+exP+OP8A56uSUrp/ /J+N/wATX/1ISU2ElKSUpJSklKSUpJSklKSU4X1ksprfR6pYJDo32W1/u/6IGfmkpxftGJ+/T/7E ZP8A5FJCvtGJ+/T/AOxGT/5FJSvtOJ+/T/7EZP8A5FJSTGFeXc3HxvSssfO1oycgTALjy3wCSm+3 omduG+hgbIkjKumEkuzh9NxsFzn0b5eIO97n/wDVEpKa/XqKDhuy7TDqYDSbH1t9zmj3enqkp5v7 Rifv0/8AsRk/+RSQr7Rifv0/+xGT/wCRSUr7Rifv0/8AsRk/+RSUr7Rifv0/+xGT/wCRSUr7Rifv 0/8AsRk/+RSU9D0HKvyaoaKTjVAsa+t73u3jaYPqNHZySXWSU18n+exP+OP/AJ6uSUrp/wDyfjf8 TX/1ISU2ElKSUpJSklKSUpJSklKSUxcxjvpNBjxEpKW9Kr9xv3BJSvSq/cb9wSUr0av3G/cElLiu tplrQD4gBJTJJSklLEBwhwkeBSUx9Kr9xv3BJSvSq/cb9wSUr0qv3G/cElK9Kr9xv3BJSvSq/cb9 wSUya1rRDQAPLRJS6Smvk/z2J/xx/wDPVySldP8A+T8b/ia/+pCSmwkpSSlJKUkpSSlJKUkpSSlJ KUkpSSlJKUkpSSlJKUkpSSlJKUkpSSlJKRHKxQYN1YI/lD+9JSvtWLtc/wBavaxpe87hDWjlx10A SU18nKxtuJmeqz7PvNvrbh6ez0bnb98xtjukpfGvZjdLx7XgkCqoQ3n3Bre8eKSmhV9b+jW2Nqa9 4c4gQWxq5wr8f3j2SU6WdmPw2NczHtydxiKRJHmeElNP9t3/APlZmf5g/wDJJKV+27//ACszP8wf +SSUr9t3/wDlZmf5g/8AJJKV+27/APyszP8AMH/kklMqusXW2srPT8qsPcGl7mANbJiTrwElOmkp SSlJKUkpSSlJKUkpzus/WHo31fZVZ1jKbitvJbWXBx3FupgMa7xSU1Mz67fVXp9eNbl9RqrbmVC+ jRzi6t3Doa0kfNJTtgyAR3110SUwvyMfFqdkZVrKamRusscGNEmBLnQOSkpkx7LGNsrcHseA5rmm QQdQQQkpkkpxPrRYHVYuA+x9NWZa9lj6wXGG1WvY3a1riRvDZ8eDoUlPEY1v1ux8tr7BVbUDS5zP SLW7Q+qy2lv6OG6h9QOzjuipu14mTmY4xuuWOe2qixtz2U+19prZsdt+zgj3bvj8ElPU5Ppf838R 3oU+n9nLvQ2D0Y+y3HZ6f0dvkgptOptyOhV0UEtsfRW1rmxLSQ33DcCJbykpxel9HzsZuL62BS5w uLrTa2svYwNqDdrmBrfzT2KSnZ63Tk3VVDGa95DjPpyDEd9t9H5SkpyPsXVP9Dkfe/8A970kK+xd U/0OR97/AP3vSUr7F1T/AEOR97//AHvSUr7F1T/Q5H3v/wDe9JSbG6V1HILg8vo2xrabdZ8NmY9J Kf8AYOd/3Kb9+R/70pKdfFx24tDaWlztvJc4uMnnVxJSUmSUpJSklKSUpJTxn156V9Yev9R6b0zC w3P6Q2xtmfkNyK6tweTW5hYXb4YzXgzKSnk+nfUD60dD+sGDlY/TW5zenhxOS/JrZXbYWONZDC4v ayt5A+jJidJ0Sk2N0L/GZg54y2U5dzbce2u+tuexgFlosYHMdfk5JOyWuBgGUlNPL+pP1/zOkXY2 TRk5FpyKwwW5rTvpAe5zrK3ZVlc7tsQfFJTVsd9Z6cjK9HNt6dT0u9uPQL8wbKjUNzsdn6Zosd7g J9NwOk7UlN/6qdeq6L1J2Z9aM/K3WZTW4tFWdXk0Nba2zc/IDbCNtQcPzu/0UlPofWnYuW7pOU6t mVi22vLG2AbHmzHudUDvEDcRpPdJTzL/ALNS+xzxhs9WXVMI6e4bfa76X0eOJ5RQ2MWzpr7LW5mN h3VNqtsqfsxJZ6QJ9UNraH81/wCsJJegyarP2BiU7T6n2cs2Rru+y3CI8ZQUnx8jpeT0ujHyL6XM dTXub6gHAaezgeQkplit6FhWG3GtpY8jaT6s6Eg/nPPgkptftDp//cmn/txv96SlftDp/wD3Jp/7 cb/ekpX7Q6f/ANyaf+3G/wB6SlftDp//AHJp/wC3G/3pKV+0On/9yaf+3G/3pKV+0On/APcmn/tx v96SlftDp/8A3Jp/7cb/AHpKV+0On/8Acmn/ALcb/ekpX7Q6f/3Jp/7cb/ekpX7Q6f8A9yaf+3G/ 3pKV+0On/wDcmn/txv8AekpX7Q6f/wByaf8Atxv96SlftDp//cmn/txv96SlftDp/wD3Jp/7cb/e kpX7Q6f/ANyaf+3G/wB6SlftDp//AHJp/wC3G/3pKV+0On/9yaf+3G/3pKeff9UvqFY99tlGO99j nPc52Q8kuf8ASdJt5d3SUvZ9VPqDa3Y/FxCyS4MFsNaXAg7WiyG89klOq1nQW4I6b6lDsVohtb7Q 6ADuEFzydDxrp2SUi+y/V/ScgGBAnLsJiI73JKW+xfVvcwusqeKzua2zIc9szOrH2Fp114SU2Mnq GAbsWMmnS4z+kb/orfNJT//Z 200 256 JPEG /9j/4AAQSkZJRgABAgEAYABgAAD/7QAsUGhvdG9zaG9wIDMuMAA4QklNA+0AAAAAABAAYAAAAAEA AQBgAAAAAQAB/+4ADkFkb2JlAGTAAAAAAf/bAIQABgQEBAUEBgUFBgkGBQYJCwgGBggLDAoKCwoK DBAMDAwMDAwQDA4PEA8ODBMTFBQTExwbGxscHx8fHx8fHx8fHwEHBwcNDA0YEBAYGhURFRofHx8f Hx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8fHx8f/8AAEQgBAADIAwER AAIRAQMRAf/EAaIAAAAHAQEBAQEAAAAAAAAAAAQFAwIGAQAHCAkKCwEAAgIDAQEBAQEAAAAAAAAA AQACAwQFBgcICQoLEAACAQMDAgQCBgcDBAIGAnMBAgMRBAAFIRIxQVEGE2EicYEUMpGhBxWxQiPB UtHhMxZi8CRygvElQzRTkqKyY3PCNUQnk6OzNhdUZHTD0uIIJoMJChgZhJRFRqS0VtNVKBry4/PE 1OT0ZXWFlaW1xdXl9WZ2hpamtsbW5vY3R1dnd4eXp7fH1+f3OEhYaHiImKi4yNjo+Ck5SVlpeYmZ qbnJ2en5KjpKWmp6ipqqusra6voRAAICAQIDBQUEBQYECAMDbQEAAhEDBCESMUEFURNhIgZxgZEy obHwFMHR4SNCFVJicvEzJDRDghaSUyWiY7LCB3PSNeJEgxdUkwgJChgZJjZFGidkdFU38qOzwygp 0+PzhJSktMTU5PRldYWVpbXF1eX1RlZmdoaWprbG1ub2R1dnd4eXp7fH1+f3OEhYaHiImKi4yNjo +DlJWWl5iZmpucnZ6fkqOkpaanqKmqq6ytrq+v/aAAwDAQACEQMRAD8A9U4q7FXYq7FXYq7FXYq7 FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7F XYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXnerfnj5V0nzqnlLULHUra6e5itF1CSCNLIvMAUb1 WlVuHxfa4fhvirXlj89vJ/mbzNcaFpFtfzR2pk+sayYol09EjDUkeYy8lSQrxQlNyRirO49W0uS2 e6jvIHtYzSSdZEMan/KYGg64qkmufmT5G0N7NNS1iCNr+UW9qI+U/KRqUB9EScBuPiag98VTw6np olMRu4RKE9Ux+onIR0rzpWvGm9cVdbanpt2AbW7hnDEqpikV6lQCwHEnoGFcVROKpKl3f23l3Ubq ytmv76B797W0DBTLIk8vpxcmIA5EBcVYtP5t/NmCMMfJqXFRv6V1ECG+p+p0L1Nbk+n2oB71BVNd B8w+fb3X/quqeWV03SCkrC9NzHIw4n93VV3q/wDLT3NOmBWXYq7FXYq7FXYq7FXYq7FXYq7FXYq7 FXYq7FVG7vILSAzzsVQFVFAWJZ2CqqqoJJZiAMVfOR/LLUfNWreY9Y806ppJutUuYbmxNhcyHhNp qMphLv6ZSL0W4uy8iNiOlCVtR038nvPNro/mKya98vW0XmK7tZZ4Lfm0fpxPJKLWP1YmWBFJBUhG Kgb9MVtAJ+S/mmPTtb0yO/0CTSdVuo9Qob6WKSBbZpEgK+nAtvStxxcNDxPYDYqrapp/5C640+iS mbQNQh0l5ptdjaRlik5S/vF4xRxhljiUUZmX4tjsMVtgujaMp02y1y/1qyt9UnM88UMvrzS3CzM0 JlvDDD6kMJBNayNzFF4LyqVWZ/lP5p8l/lvNZLfWkOoapfSXSXHmC1+uoqWJEXoGJLiFVm9aZeNU CUHEmoJOBL6i0/Ube+id4eSmNvTljkUq6PxDUYH/ACWBHYg4oSe5t7a58patBdJPJbyNqKypZ1+s kfWJv7mm/qfyU74q82XQ/KNvHBaG182yWrxtb+kQ7JaidYy3HpJUkqOUXLff3woRkSeXbTTbaOO4 8521of3kEUf1vlxHGNeQjVmjFSH4vxryJYdaKXXaeV7GOU26eboLuURwXLWYuUllEFukEYaTaE8U j5clata770xQh7ez8ppZWk0KeboXtdOn06MlJVnNvZsLlkZivxFhcenHQ8SF4ruAcUosP5ctSbUS +cLiGWG7hkR47owrHNE6OxjkRUYr/uuik8iPfFUVcHQ5JVuJrrzXcS2V3DIwKXARnnne2rw9NIvT CszOqAAR9ugxVboB8t6AbMWT+aWg08yBLOVLmSBwrMjM8fHgVPrkqBT7NabDFWRad+aeg311BZrY 6rBdT8R6M1hcApyeOOrlVZeKtMAWBKih3wKvP5l6SE5fozVifiPAWE3Iqi82Ybb7Hp19sNKyHRtV h1XTo7+GGaCKUuEjuEMUlEdk5FDuA3HktexGBUbirsVdirsVdirsVQ9/ZLeW/omR4WDJJHNHTmjx sGUjkGHUb1G42xVjMX5a6GkskzDnLKzvJIfUqWloH/3Z3Ap8sNopND5WsSrpsEkdZHQKQpZPs/CG 4ge3TBaUO/kbSCY2VfSeFUWN4i8bAR7rujqa+J798NqrW3lOwtrS9s4lQ2motI19byxiaOUyikgd ZC4KsDQr0wKgrf8ALfynbNE9to+lwPDJ6sLR6daqUk2+NSEFG2G4xVbJ+W/liQMDpelkNz5A6baE H1CC9ap+0QC3jiqfaTpNtplu0MHR25tRUjWoVUAVI1RVUKgAAH44qppbSzaTdW9tObOaV7pYrmNV Zo3eV6SBWHEkE13xVIrXy158ivhLJ5sEtqvACE2MdSoiZGUkyHf1KSc9z+ydsVdD5Y8+x6eLf/GJ a6Ds31ptOgNVaHgFKFj9mb971/yemKqJ8r/mPNCVm85iKT1GdTDp0FABKzIpJapUJxBHc1qSDTFV 2n+VPP8AAgW686G6ZIDDE36PhSjkRgSv+8bmw4N1/m9sVVx5b88FuT+bmYi5SZALCBQIF5hoKBhy 5hxVmrSgIGKrLPyr53hvrW5m84SXEUUkTXVubKFVmRVUSp9oiP1GUkFRVa0HuqqWflzzvDavFN5t M8zSiRZzYQgqnqyu0YHIijJIie3DbrTFUOPKv5gqyOPOpLjkJeem25VlKsFCqrKF4swau5NKdNsV VD5b8+pbiKHzdWQ3frtPJYwMRb0mLQca/FV5I/iqpATbrTFVsflj8wRamKTzqWnMaD6wum2qkSKz lmC1ZeLqVUqa9Kgiuyq298q/mFO6PB51NuY+bKq6bAylmEiryBf4gqyLsT1QHxxVFv5d85M0NPNb +mlusc6Gxt6yTUcSS8l4lA3McVX7PEbneqqGby3+YpoiecERVWnP9GwMWY3LSbqX24wcYa8t/tdc VR+i6F5ps9VF1qfmNtUslgliWza0hgJkeVXSVniIqyRrwpxANa7YqyHFXYq7FXYq7FXYq0zKilmI VVFWY7AAdSTirdRWldxuR88VdirsVcAB0xV2KuxV2KuxV2KuxV2KuxV2KuxV2KuxV2KuxV2KuxVD ag0q249KQxO0kS81CkgNKqt9oMNwfDFXnPm7WfN/1520rV746akskEJ0iHS5ZOcFEn+svqACVWYM irEu3E8iagKUFgnl/wDNPV9e+snSfMvmS6FoFM5Fr5bWhflwABjqSxQgUxpFvVdG8zyTabeiW/vL u6sGMYuVsqCQNAlxEZVihdUb05lD1K8vtqqoyjFK7z15w0qx8u30lzb3EtoLW4a6gltZkWSJI6sp 9ZI1oRt1xUvHPyi/OJ/MGv8A1W1sbWzk0+zEFtxaaWdrX1V5As7upVW47u3KpFKitFAL1W+8xa1+ kbiGDWLq2RbmSNFk0SWRFWNmjZfV5IrqXWqP3XxqDiyWHzH5rW+Iiur2a3ZysK/oKSVfk08U6xmn 8wota9uih6JgS86svy+/MOznnEPnuf0JxcNyltvXZZJUVISBcSzgCNgXohVSdgq4qiLzyJ59ubwS Hz3cJafGzWsdnFH+8aRyCJI5EfgsThAnioYmuKrR5M/Mh2ktZ/OTPZ/UhFDdrbpHcC7F1HMJmSMo OIhjaKnPfluMVV7jyP54mu0kPnm6SBHTjDHaQIfSWodSwNGZ1p8bKaGpAFdlWpvJHnu4S2W487TA wTLLJ6FmsAdVeRih4y8qFXRfiYj4em+yrv8ABn5i8XH+O5Ku6H/jnW9AiwemyL8VRzkPqVrXoPEl VnOKpZrsMskMTx3stqYTJI0MJjDXC+i6mP4+JFOXNSrLRlBJpirCbe78xyWq+le66sanjGxTR3Lx ycgKOZnLBfTB5luXxLvu2FVsusecfQn4vrMRU8YZjFo5UsUAHL4pKLzVj8yR0AxQnOjPq9/HHdSa /eWYeeq213FpvJ0X940SmD1EI4GhNS21cUpvotlqNtMZbvzC+qxCMxtFJFaxqJeS1flCiHboFr33 rtQKmsd7ZSU9O4jflXjxdTWhINKHsQcVVgQQCDUHcEYq7FULqWqadpdo15qNzHaWisiPPMwRFMjB Fqx2FWYYqp3F1bXNqr28iyoJ7cc0NVNZI2FCNjVWBxV415p1W50nyDreoWt6unTw6tqpS8khe4VC +uzx/wB0gZm5A06bVrhYsE8vXM+na7Fa6f8AU9Nt7vWpbK7gtNImiaRbe2DR27ui8QVLtL6jGhBL AhVZcKHuHkJYzonmqdNvXv5eSfymGwtrcD7oQcDIL/zU0Dz1rCaIvlSe3gEF4H1cThSXtDTmiFqi pp0pv/MvdUvObj8uPz2MOoR215ZKZdWaewLv8Saa7yM0LSr8Qb41CgD4QNm6UUUyXUNPu31K7V/K n1uyW7mkamkxF5A80nFkkku15MOvPgB0NKYpZh5c0PzNYWtnDBd2dppasZfqEVk0LJHJ+8MQBlcI 3NjXsOgGKWWYFeUv5sjGmajb6X5uvlu0Sa6tjJprTtCkNvNI8RknQqx5Ly+OSvw8dqnChCWXnx7z TNVuo/N19NLYxWoltDpltDNbtJcrxn4koHDKvGRefFVYEgE7qWYW+g+a71frtv5xla3uEiMFLKBQ OE3qFqGn24yYyCOlD1GKqw8sedCAX83ymRZUkRlsrZVCKvGSNlA+IPud+hPywKpXHk/zg807w+c7 uJJ4o4nQ2ts9GRFR5E+FQjOVZvgA3b2GKqh8recVurqWHzfOkE7yyRW7WdtIIjJ9lQzgsVj/AGRt 74qytQQoDGrU3PSpxVA61YWNzaNNc2qXUlosktuGiEzK5jZTwTbkWVivGvxVpiryR9EtVtbiI6PH HI0R+A+Vbp4R6jeo4ZYZXMnPj8SAkcqdDhVk8/5aXlyknpvoghf4rVZtFJeNWZ34NW5BP29/s9+m Kqcf5Syx+kA+icLd29EDRgD6RA4x7XPH4TsGA6danfG1VT+V93LDxu5NEuJCU+3o/wACqKFgi/Wa /E0cbfEx+yMVX/8AKrIzEgdNFeZQiu50k8GAZi1UNydyrUry+fYBtWSeXdH1rTaQ3N5aPp0Ufp2l jZ2f1VI6N8O5llrRKCgA3qcCp3iqldWtrd27211ClxbyjjJDKodGHgysCDiqjdxRRWkccSLHGstu FRQFAAlQAADwApiry/8ANJItV0nzF5f8vQT3OsWUlvJPaWNylhKHupI7n4bmQMiMRzkfbcGnVsLE vPdK02/bzNDcQwP+i7TXNQ+u3EesLLHARBEFDxxn4Ynkqfq7/Er0qQpIJQ9a8qX2m2Vn5qFxf2yf Xrz6xaJ60Yqj6XaIwUV/38jj51wMgt/Mu81PVYtEi8p+YNPtLmHUoZb4yvHMJLYVVo0QByZGZl40 KnwYYqXmuk6l5+17V9c0zRfNdjJeaT5kWa4t5LWZDBp4kmVonZ4YlnlLRhf3dCOJ/ffEKKGU6zqs M2p6lG2lSs8d3PSSG41OKJvQZ0Qkx28ixyUIJCtQ79sUr7LTdR124uDodkvo23prHLLd6lZkItDE wBCNz5RMWZCfi6nFXpXlrQTpVqrSTTvdSov1iOS6uLmJXHURCd34/MUrgS88utZgMcUrXaQyT2ay tENe9FvSVpBUAo8ciD4viI5bHl0GFC251hIKNLfxorrAZWk8zxxgr9Wj5E/u/iFep/a+13xVD+Yb 2SW7voodUsTbNNz4p5jMB2h9MU5IXjUeq/IK+xINDRaKuFwsUVpZW91DJNCUkZj5iCGWS5iSbg/q I7E7hUptx3AG2Kqtnq8FxdyMmq87S6tTJFdp5iikUSMnwK0ZCsV5txDcdqEkdMVZfoflaS90e0e7 vNRtpYZJJLUpfif91IVKUlReMkZVFK8xUfTilmWBWnJCkjqAabE/gOuKpd9cu/8Afv8A05XH/NWK u+uXf+/f+nK4/wCasVd9cu/9+/8ATlcf81Yq765d/wC/f+nK4/5qxV31y7/37/05XH/NWKouzlkk jLSNyIalfSeHag/ZkJP04qr4q7FVC9imlg4whTIHjcByVB4SKx3AbsPDFXlln5I/NfSdc8w3enHQ 7201rUZNQSTULi/a5RXVUSElI+PCNV4oP2RsNsKKXW/kz8yrcyNDonlGJpp2u5jDLfRc7hyC8zUg NZGKgljuaDwxWmV+VtK87wafq0fmFrJ7nULhnt0tLi5kgt7f6tDbpGgnjBG8TOwWgLMT1JwKm/mW FP0e940dxP8AVEZ/q9oGeaStPhRFZOR26YpYzoHlzyxcvMtlplzZw6vH+kLt5LWS3juGnCmT16ne ZudGEg5HfrTChSn8kecW1S6vYdRt1je5lnt7d59SKcJXZijqtwirs37I49uNKYpRuj+QblkZ/MF5 JPdIwEBsLq+hi9JW9ROSPNIxYOzVq5qKfLFWZqoVQo6AUH0YFecanq/kaa6Oor5oi0u3tpPRms5I IECVidmjZLiLmvNIZGFR407YVV9L1bygCW1HzPDqlvKpLW15bWkKcJZnijdgsETAD0inJjxIWvgc VTC286/lVMkk0GoaYyKY/VkAQAGUM8fI8f2grsPYE4FWjz/+VkciBL+yDsyiMpETVlUhaFU7Kpp8 sKuXzx+VaSCKO9sBxCJySL92okUOiGQJwBIevEnviqNk/MnyNDNHA+rRKZESRG4yenxkZUQepx4B izAca19sCpjp3mrQdS1e90iyuvV1DTqfXIeEi8OVCPjZQjfaH2ScVRGq6zpmlwpJqFwLWKVvTWdg eCtQmrPQqgABNW2xVLp/MPl+3mkhn8xwwyRAmQSTWqhaAsakoACFFSPDfFWpvMnlqBoln8z20TTk iAPcWalyrMrcKr8VGjYGncHwxVSPmzyuLeS4bzLEsUcSXDlpLZT6UkQnR+JQMVaNgwIGKrv8VeVu TKfNFsrKVUhri0Xd1VlpVRXksikU61GKrrXzJ5fu7uSzt/MKvdxs6NBytw5MQJk4qYwX4gVJWu2K o7QNZ0rV9PW80zUF1K1k3WdCh28PgC08dxiqZYq7FXYqpz3NvAFM8qRB2CIXYLyY9FFep26Yqpvq OnxlQ91CpdgiBpFFWY0VRU7k02GKq0cscqCSNw6N9l1IIPyIxVdirsVdirsVdiry/X9QvbfUlt7O 8vJ4FjRrdrSbR3F4zhlA9O9ZTy/e05D7XGmFCyceZmZSBq0JD3KOok0USECP93KVK7oXkLD49nH2 Sm5Up/Boct1axyp5puII6EyxJHpwK/CFWJ2WAbwlWp3BJ9sVVV8rt9Ztpf8AE85it3JaAxaeQ451 4M3ocvskp1rQ+NDiqw+UmEEUbeZ5uAch3MVgGdwqFV5+hy+H0mbrXfrQYqmGnaVosMBt9TvoNZuJ ZQUnu47MSVho6RgQxxK3pMC4+GoJrgVNbAaLLNNdWAtnm2huJ4PTLfD8QR2TfbnWh8cVSzzmBJZQ W7QPcRztMska2sV3HT6rKR6qS7AEiin+agb4ScVefiy1O8iuZ7iwvJCyB63Og6c0nxgQlvU5okrB W3+EfD2phQr3Wnyw2zu+l3l1cLFygMGgWIKggzNGQ5avJpG5KCPj+nkqgLSx1CS7t1vYr6S3BiWW NvL+mRpxhQQrCJG5BU4Cqn9nb9n4cVZSnkusS89X06ro4+PS7IE/BGqNxIWhhEdAD7V6UxVV/wCV d3v120v4tQsjcQSSyNM2mwMXS5eNpVry5DkEfcH9rwFMbSnnlby3eaGbqFryGewlbnbW0NrFa+iW ZmYViNGHxdx/aFT7FXYqlPmN9d+oPDpFt600yOhmE6wSREgBWj5xyqzbk7jtirCrjRPzCv4ni1S3 a8gLSH6tPPps0Z5IFQ8ZLIrVKHjsK8t8KpZF5K8yETRWVpBCIW+r3UEcOjj4nEU6tvYcaAdV36g1 qMUJvYaT+ZdoEjjkmS2gJit7aOXTEjEYNQxVLJAvhxANB71xV6BYyXklpE95CtvdMP3sKP6iqfZq LX7sCVfFXYq7FXYq8x80ackXmBltNLRbe1REjEPl9L/lGV5lEuA0fFVZmbjT7XTuMKpFPp11eQPL LpjSevGknof4TUOzm3j9QMJZQgNWccZCw7VJXFUaulXMlyLm208W8kBWJX/wvErfDEWb4nlDGMvH U8ablQp7lQ1LpTx27005uUyiRjH5Xjq4RYpArASVALABVJDhh1+DFVn1VlVbEafJ9UkZuQTyqGhE sccrmR0EhUOxaleG5+EUqSFVa3sWSL9/pbSQckd7ZvK68HjCpVSscnLmOL1atPi+FdsVZj5It9aA muL6QR86/Wrc6dHYyTXLBG+tO0c1wrFk2IrUdGoRTAlH+a00lra3F9AZZy0wsJBFLKscxtpQS3pb gPHySn7XLj1OKvMbG0sZZ7ktaaZD6g9OS1j0zVQq1UkhfTb0uLAV+EEYUIeGTSY7aFCmnfWYpFeY ppmsATD01MNaoOLACXrVdxtsaqsvhvPytRlnj0+YS24jkC/Ur9fijCJH8MkahiOKDcdt9hiqN0fy t+V2t8rmw0eBngZi5e2mtnBlf1DVZViYrzWoFKA9MUs1VVRQqgKqiiqNgAOgAwK3irsVdiqW+ZLR 7zRri0SUwvOY41mXqhaRQG2I6fPFXzJpms3N7It9F5jk/RcjV9Z7i/HEKygg0hMKmrr8LShuopUE ZJgrG/8AM6Jp1zdNeaXb6j6/rzXNyVSHgVWJ3ZGYS+qRwX0+VOjUxVkP5b6vqVp5jNtrF695+kEu rKxT1ZZCl1a2v115ClyIXCJEAOaI3xOg2rgSHuev63BpVhLOXX10AZIKc5HFd+EYKsx4g0wMmI+U PzSk8w2F9exWYcWXEeknKAP6ghZCsl16A+xNU1XwoTXCrI9A80yavdNA2mzWgWNn9V5rWUAqwQxs IJpWD7+FNjv0qFT7FXYq8l84XukX2rR6lbT2C2+o2yxzy3kOper6YdHVT9XkjCpyi7heh674UJdB daN9ZurhL3Tv0ZJG7wxfVtZM0ychPEORnVUVqKSQhpQ7EHZVD+rYzzRSRJpjPUtX09bYRyS/FVuJ AUMRRvE0BPTFVZrmNbnUBaJprSwkfo+ctrJdENw3L11Ug0UcDyRu/TFU+0Zfyvj0eFrkGCVol+t+ g2orCXqbgkE8dmaEuK77UxVVu9X/ACgjMhmWWnwLI/p344kRPGlNgwPCq1UeHfoqy7SfOPlzUruO wsLh5Llo2dY2hmQhY6A8jIi0O4674Eobz3fXFlpsE9vr8OgSiU0muUjkhl4xO/puHVmp8FTwKmld 8VYfqf5ntBq8sUXnDQktdzHG1rcySUjlhWQfBIV+yz0bketaUBIKrD+Y0sjy28fnfRlmWFTJILWV kSTlGp4SVEfIjkeB5Nv0p0Vc/n3WYrySx/xfo4umjtHi+sWc4j5TQKpKyKyJSSWRHEZJcAkcqDFU XFrPnXXdevbDQvNempNptxJ69kLGUkRo6qY5Hk+3RgV5x8ag1HYhVl1nZed11lZrzU7KTSBJITaw 2zxzGM+r6YMjSSCq8oq0UdDgVP8AFXYq7FUNqH+86/8AGaD/AJPJir5M/Ky61bRvyo1e/tEllvJb uXV3eBgjpaSu9mXLFJqUexm5fARTc0G4LHoraD52tm+oXQ1K9Fxc3AtrazWSGa6LSFPgeGC1B9Nm kZIypLMB2OwVtllvDeRfmJ5bW/tmtrrUpNckflITLCYtF08sEaNuFHEao4PL7Jod8Ve36xYWGn6L dy29vxKASSGPmZWCurEB1rIWIXbfAyYX5JsLW70iXRre/t7x7iE3UVzLZTyRtFMYJB6kdz9s1B+2 4ap+zsThQn+ieStY0i6We1v9NiBdfrH1fSY4HkhDAtFzjmFKjoaGm3Wm6lmGBXYq878/X/1fW1Bv Wt2McQSMa3+jl+01Ga3CMd2ovLo3elMKsW/xBcW+sRWsc80t6xRxGvmGVya0WFpB9WZGilLqBtSp 7g7KFK21PTZBG1rdiN4UCqD5mmWNX4QyJ8UqBXbdmIqSAK9wMVV7jULe705+d3E0wkRY3fzJI0jL LSGc8o4+aBKCmxFW7Yqi9Ps9Qi1Eafpl1JdSSIxCJr0rSMHtRNyQsG5CrijU26jbFU1tdE86WuoW E4069ltxPEbqJ9baXhEkkdDxdURwq8mKU+KnGorXFWcaHd67cxStq+nx2DqyiFI5hPyUoCxJAFKN UYEoPzfdPDBaRoH5TPOAySRJTjaTNuJdm6dvs/aOwOKsEtZtantbm6B1RYZIxJGGm0Z0WNyFb05e HqErXnVzuO/YFDru5v8ATrCUytq1w8yKUeSfRYCsnpFylYiq1PFlYEduQ+yCFUmsZbe71aA3dxfX al45542u9HKs9uoHJij+px9NalgQRsQO4VZ5F5diWSe4Hmy4hl9OT64ym1VwHRHrIxRmX0lQsu4p Uk1xSrSaVdyS2aw+dpw7OJoUP1NjNGXjHABUTmpEbLWhNWO9cVTzRtH1DT7m7kuNXuNSgnIaGG5W L9xStVRo1Qld/wBqp98CpriqB1ywvr/TZbawv5NMu2KNFexIkjIUcPujgqytxow7jFUOlne2tm4v L1r2SS5t3Dsgj4gNEhUKpI3ZC/zbFXy5oOnWsn5G2E8sJkc20xeUFisIg1PUWSaWNY5zIimRgV9M 9eXw05oWHRgejaFrVymj362gl0+a8KfDAzlBG8QkMv8Ao9z6iEH4R6c3Q/B+ySinuyQM3mr8vroW stnFYWWtm8tnZ5/qzTafbW8UHqkHnQrx5d6E4Gb2XUPNFjHaO1nIJbqqrFEySUYswWnRdzXbAlIv L35g3up6PLqk1h6axcgLUhrdyyyRptLcmKI/3nY/ThpU307zat1OgubM6daSRtJHc3VxbUYjfgBF JLU8asd6UHXArIMVdirzh/zJvJPrEk/lmIGJjHA0upWFZUC80datsjcl67jkNt8KrIfzNc8ZpPL1 rFwZFMx1Gy4iIsAjK3Xp8Sig6demNIZk2peT5D8V1p7mAhDWSA8CV5Bevw/ClfkPbAlYmpeSpwI0 utNlDguqLJA1VFakAHcbYqqfXPKNo4l9fT7d7ctAJOcKGMrVWjrUcacCCvt7YqrN5l8uKGLarZgJ u9biLbdRv8W394v3jxxVfa69od5MILTUba4mNaRRTRuxpUn4VJPY4qo+YNKN/DAwELfVHeYxzWyX ResMkfFA5Xi37ytQd/s9CcVeYQaVIt+n1jTVlkvUZZ7mTyrEoeR4qK8rLMGqH3IPXcdN8KEdoehX l7J9Sskh02G4hcXbTeWkt43EboFSrPwG68lDcvltiqdWv5b3lvHMsd3pSNPC1vK8ei2yGSN4/SKS Ukoy8Aq8elFA6bYpXt+Xd2YSBPpKzupR5Ro0I2ZQpoBKCK71+L+1tUz0TyLo9nYW8Go2lhf3NpM8 9vdLZRwFHkcysUWsnE82b7J6bYFZLirsVdiqG1D/AHnX/jNB/wAnkxV88eXPy+uoPKiaDrUnAafP LprrEYvU+tLqd9MriG6Vo3SSC6gkj5odpFddwGBY0hYPyn8rSzRWyWGoQx29x6sJP6KlWGSnNw6y GZpQ6wFmjnWQAfZUAjCimZab5HuP8R+W57VXtdK8oWutxlNpVIuLOyt7aDnyqOSM8gJ5H4CDQ9Ak B6j5uNPLt5tKahFP1cEygGRQSnEMajrWm2Bk83/Lnyvaix1DSLORlW5ht7pbiWzuPqpRlgeMCK7a QF+CBXBcU2AX4ThQmyflLOLNYANAi4An0otEUQOSDs8RuD8NTXZvnXFLPNIt9Vt7Qx6ldRXc/IlZ IYfQQIaUThzk+zvvXpgVG4q8u/MCxLavJBDpckiEJOLmHy9Dqa1HpAD1XccmBi2+Co/2Iwqxy102 ZI47qfQ7x7a1VC9hH5UsY5Wih4l40PqOKuHKqF7glRSlVVj2F2k22iXZimRbiaP/AAlZnmqSNCI5 GEo/eULMvgj/ADGKrksLyHSY73TtEvbO+QSwLIvlSwE6neNwsXqpxjlEsp60Ic/F1qqi9QtLpkVx pN/Ik6MrI3lmxlYMVkiUuOafCGAfid+NATvihPPJnkmW5u4tVm+rQ2ttcSxvp9x5ettPnbgStVkJ ZghPFkdeoGKWd2flbyzZXS3dnpFlbXas7rcQ28UcgaSvNg6qGq3Nq+NTgVLfPaao2n27aZPf2tys 3w3GnwrclfgbiZYGePmgahpv4EUOKsYu77zsuoyta6pq6Wfx3Ii/QkcgoxiZYA7vz2HKoC1ozCoZ RQqgpbj8xZLQRt5g1WOb0Y4ZjHoEZ5y/AZZYfijdVoeO9KHcYqj4289lQsOt6qoZBCiS6NbsRJDG gaXmzjaVmqPUPWu9BihBWtz+YNJIZte1prglP9J/QFtHGQpk5JGpZgpY0+J+3HrucUti+8/XGrQw z6jrNmpKq6No0BiI9Rq8pYLiQUHNKsvZeu5xQ9VQMEUM3JgAGalKnxpgS3irsVU7i3iuIvSlqUJV vhZkNUYMvxKQeoxVDy6PYygCUSOB05TSn9bYql9r5H8pWl0l3a6XBBdRghLiIFJFBBUgOpBGzEfT iqYfomy9No6Sem1eSetLQ161HLviqMxV2KuxV2KuxV4953sNA0/zCVi0/TreMmC2Ytpuoyx+kxDM pNo6QOa3DNxp8JIZjhVIDfeXZLO+E1tpXAWyWt8i2WrbylIF2RZOSx84z8IHIjjvUNVQy7/lW17e X7anFp3l6e2uz9ZDvHe8pTIHflIPVKEOZmrUH7R69MUtR/lNeW1m0NjpmgwPw9JVYag8fBreSB2o ZtmPMBepVaipNDiqzUfym1T04oNN07y4YI5Gm/0mHUA5d5HZzyS5J+JXHUmjV612VTPyl+WKabqj 3GoaXo6W5b6xH9S+uGUXSy+ojkzyOhADN0Xrv7Yq9DwKxD8xYLOS2057p4UWO4JQTx3UlWMbbKbQ h0+GpLHbt3whWCzW2kBY1tYtO9BqC29SHWSxWXlMvMKX/ecZORBru1K7bqFOTSNGEkzw2mlIGI58 o9Z5ODREDNQHcRrsPtfrVRskpOoNdJ+jjeXQZJz6ethpGlqX48R0b5YqhpLfTBD6bw6d9SUvdiMR a0AZXUxo52oQWjSvcgbYqmem+RptVhnv7ew0aW3u1EVWOoqx9GSrBg7qwUvEvEU2A7g7qvUreCK3 t4reEcYoUWONak0VRQCpqTsO+BKpirsVWyzRQxmSV1jjFKu5CgVNBuffFVD9KaZ/y1w/8jE/rirv 0ppv/LXD/wAjE/rirv0npv8Ay1w/8jF/rirv0npv/LXD/wAjF/rirv0npv8Ay1w/8jF/riq6O/sZ XEcdxE8jfZRXUk0FdgD4Yqr4q7FXYq7FXYq7FXYq7FXYqlXmK4sIbeI3VybeUmU2oErQ+o6wSMyF lBoPTDGvUUqNwMVeVLqtv9UMMmpKpkiULE/mWZOpZipIh4wMklIwDvTbtuUIi51F7iNwNSSE2xEM 7jzRcR0dyUB/uqCh6FlYE7b7HFVv1qMS+p+lG9KVRIS3mmeq8pAV+xEzBKnjuBT6TiqdaXf+UFgt 7rU/NL2d8xRjaR6yZoqU5whWqolVomWQ/DvWpGKWWSef/I8UfqSa/p6IAWqbmIfCsjRM1OX2Q8bA t02OBUz03WNJ1SOSXTb2C9jib05Xt5ElCvxDcWKE0PFgaYqi8VdiqG1EVt1H/F0H/J5MVRAUDFVk 8npQtJTZRU/LvirzfzF+Ymrtrc2maTCDbW4Inuo3WRzyjjljZUUO68k9TYK5pRqfEuGkWjPK+t+Z INemsr+1maxd0jS9muIp1YytK6+l6b1AjBRHJjHJm+H4U5FV6BgShrv+/sv+Mx/5MyYqicVdirsV dirsVdirsVdirsVSPzTa39wll9ThuJikshlW3kgjorW8qguZ/wDLZQOG4NG6CmKsGt7nzHcXXAjU leNWkYPeaGzNG0nx8eIdiFqd27oy8v5ihTjm10xvbWMurTXZmthIktxoSkNxLuD/AHn2mehULTkn wUUklVGfoTzetvGIINXqFIeKW401axvKr8SSZ/jHiCNuhG2Kr5dN82IDKlvrs8gWMKC+iA1EPCqr VY6hnFajqgoetVK1dI82rqdqzW+tPb+sgnUyaM8JT1CfjX4H4cR8YjIJLftdlXpUcMUdfTRUrSvE AdNh0wKuxV2KobUSBbqTsBNBU/8APZMVYL5k/P8A/KbQoQza/b6pOwHpWmlML6V6mlP3JZF6ftsP 1Yot5/b/APOTV/rHme30V/KtxpGh6otzBYanfM6zSTpAZYaRiP0wXYopQO1OYPLxKLeQ+S/PXmjy 15K1X6pUtp+o28Woz3Ss/pofVjJTcCtY449+m+1aYUWn3l/z3qN9508v32pLcanHaalcSQTytGhm ib03S3SBjFaCeIgMvEhuTKAahMVt79+UN7NeaFc3l5Cpnhvp4pLxSyuzo7RsjoQH+DavLapr1FcB ZBlNh5n0DW7iEaRfRXv1a4ZLj0Ty4N6Uq8W8DVTtgSnmKoK61aK2W6lljZbazBa4uWaFIlVUEjMW kdaKqncnFWKt+aUf2o/LWsPE28cjLYw8lPQmOe7ilSo/ZdFYdwDtii0Rp35jLe3cdv8A4e1WESMq mVvqMqrzYIpZbe6mk48mFWCUUfE1FBYK2yeK8Z7hYHt5ImZGdWcxkEIVBHwOx/bGKUFqfmBbCwnv TYXdzFC5jCWyJI7v6npAKvMGhf8AaaiqPiYqoJCrHJvzSEIJk8s6soHcvpY/XfYotfpv5q6XqEaN FpOpIz7em6W4YGtN6TsPxw0tp7oXmnT9Zuby1t0kiuLD0/rMMpi5L6pcKCI3kof3TdaYErPNM+ox w26WZm4zNNHOIbVbscTbyMvNWdOI5qADuC1A2xJCrzyHSbwWxjk0tj6SiNGby1a/EpWhUKk1KlZC GNAux2HQlCf+XvJsN/JBqd5bWLQJNIwtLrQorS4A6fadmZfi+JWA+dcUs/wK7FXYq7FXYqgtatNT utOlh0y+/R18Sphu/SSYLxYMVaN9irgFT0O+xrirD/zA8s+bNR8i+YdNTUxqNzqMEMNna+kloOQZ Fli9VWO1xQj4vs8vDCgvk/RfMmnWhdfLuk2uhCOkb3dy36RvQ4Sp4gLDGGD7GpX5HCwQcOtX83nz y7f+YtWubyys9Stbh5bhj6ccazRNOYol+CIFU3VfDeuKozVxdi48/WRR4eWoS3sUKU2Y3cbQcgQR xVbnkfbFS1b29zqPmG1ufrbT3d1dxzNfWiMWeWZgzypRomDcmqFBG/QjbFX175I8rrptxqN/EyXN nrN3NqVteCSQSGK6lNzHE0JjVQqNIeJrypQHAzZLNBDDNZrDGsamdmIQBQWMMhJ27nAlGYqw78yW K/lx58YdRpeoEf8AcOxQXk3nrWru/wBJ030bfVuf1WHW3n0o29W9LjygkWf1A9fU5+m0ZEnGgr8V JIKYeT/NL6Fpl1JHaXipoMc9sJb+RZJLn0LYyCbmhPLlty2FGqOoxW3uMn/HSg/4wzf8SiyLJhHn /UJ7KPysYnZBc+YpbaQKSAyzW1+tGHccqH5jCgvMfONzfz+ZDex23mCH6jKtgLeyms4rS4EQF96r GYvSN+Coz1Xb4D1ZcUMs8t6tdXGs+SrxPrFomrXrmW0lPFhEdJvpvTkVSV+2qNTsVGJUPR9K0WCw 8yaxdwKqpfxW0jqOvqB5+Z6dDy5fMnAyQnnkRtBYK6QOpln2ninc1+pzj4Hg+wd9+WzCqD4mGEK8 4lt9M58E/Rvoxo0Uri21mEcQzCrIponSpQNWvfauKERZv5cttQeC+itxpUyvHJHAureu8atzUKWG /pmOjdNq9KmqrJJ4/wAqZYEmnhkeMIQhaPUCSrMHO1ORPw9etPbFUdpnlj8udbguGsLPmoEkEp/0 mB0WeLgyqJCjKpTYcRQdt8UpgPy78niFofqJMLDi0RnuCpXmJOJUyU48lBp0wWqraeRPKtpMs9vZ GOZXWUOJpifUU1Dmrmre57bdMbVPsVdiqG1D+4T/AIzQf8nkxV4L/wA5C/lGS0nnLy/ahakvr0EQ 6n/lq4e/+7Svs5H22whjIPnyaOO5t3tptq+O5BHQjCwega5FqOs+eNTrGtmPOmmrc2it8QigltUj UPQAU/0UgGu++LJmXl3RtG0S3lgfT7TUEMUKXMso4WUQtYxDDcG3Z5ouSt8TOPj5M1D0XFXoHlz8 5LqSJRq2npLGoY/W7N2BcCvCkMwXrtuZB8h0wUm2VaV578v65fafa2zyxXryO/1SaNlYKsUlfjXn F70D4ptMdQ0/zNNqcktlq0drp0lr6a27WyyyR3IYkTK5ZeSsrCqMNuO32tglBec9OutT8mecNNtI zLd3tjd21vEOrSS2IRF+lmxQXgf50adpVlcwW7R2hW30C8t43n067u2IgaIcRPAQiKCPtneKtf28 LEt+VY9Mn/xPHK0UNpe3EnM2tlcwO6y2fpk8Ja8iWBHJfgJ+Ko5YVe4eWvPKeYfMQt4dOntbeK0n kE1wVDsRLCvH015U2Na8vowMrVvMnl5dYs9MnZ+H6H1WXUVWlebItzCqj/ZTg/RipfP3m3TtPXzV qont7JyfMETOZtGu7wkPpLt8SRFVn+L9ldl/vTu2LEvSPyu0Ke50LyBdwIvpaT6dxcenG8SCObS7 uAFVk+P7co3P2q174pD1uP8A46U//GGH/iUuBkgPM2mXuoW1tHaMytFOsrsk0kDhVVvstH13psds VeeXerC21GdVvbcS2t7cT3ER8yyWqqkMjyOZYvSfZQB6idB07HCqF+uQMbVV14Dizxy080TAswiV lClo2DMqzVI+XyxQqRahCZ45LbVYWt4pY5I/U80TSRsxU8YyvpgUrGaDka0Jp3xVF6F5lbRzI312 0mKwSx20F55ia7DCMkIxDRPV3kVVJA+EHvTFKY235pysWiupNDglAb4v0spAC8lDsPS2VihpU96V 2JxVNdJ83+YtUmuY7Ow06WSzYrcwJqDMyNwNELC3p9sU5dMVZhgV2KoXU3RLUO7BUWaAsxNAB6yd ScValvtImieGa4t5IpFKSRu6MrKwoVYE0IIxV8mfnT+Uuo6Rr0135Rt5b3Tbus9vHZr65iav7yBl j5MAvWMkfZotSQTkmBDOPyZ0/TNc8u2K+ctDnsvM+jsYre7u47u2eS0iT0of3pWJOKpI0fo8z050 qa4FDJfPflu4uPLVzZ6OY7q5/f8A1ZWkiVlW5nE0kcZPFUSoA47bKvWmKSwfR7TXLSAWtzptyJo/ gciJ2Wq7GjqCjDwIO+FDMPIdvdf4x0mSS0miVHn5M8bqBW2lG5IpiUh7TkWTHfMer3GmaH5jubDj Lq1vbzz2FrUc5Z0tFaJFU1rydQBtirxiT84Z9R09Ir38vvMilhG1xGlq6j1UKyHi3KNmXmO4HIdR uRhY27SPPNjqGpxac3lDzLpj6jILWLUZbBBBavOwjW4lYtxCQc+Z5Aig3rioe36dYaJb6rG+mhOX oTK5jkL0BeI/zNTpgZMW/MrzXrvlvy5b6loVg+sTWmqMdT0m2KNcSWjtMvwpRpDxlaJvgFaDf4eW FDzrXPzOsddgtV1H8vPM7LaTrd2rQxTQSJKqsgblBNE/2ZDtXFFsp8gfmNda1r9ppdvoes+XrK39 S61G61mARwzQrE8aW6TTPIxczTpJsa0QjpXFIep2s8E2oXDQyLKoihBZCGFeUm1RgSlnm7U9e0+C zk0g2I5z0u/0i0qJ6KozvweOvF1VS3xAjanvirDNP/MO9nvLaO4m8sNHdyxxyMl6yy/veQdFjeP4 2qUAJYcq9OmFWVx+efy4aINHrOmFPTFzQTQ7RuyxiQiu3IsowKui84fl3LPEkWq6a8sjILdhJD8b srcfTbox48vsnYYq2vnX8vWCImsaawZCyKs0JBRRUkUPQYqtHnP8uy5VdV01pKhWVJImYchz+ILU gU33xVP7WGxCi4tUi4zLyE0QWjqxL15L1BLFvpriqvirsVdirsVdirsVdirsVdirsVdiqX6noWn6 lc2dzch/WsXZ4HjkePZ6ckbiRyVuIqD4Yqv0fR9P0fT49P09HjtIa+mjyyTFQTWgeVnangK7Yqjc VdiqVap5b07Ur+2vrhplmtkkjAilZEeOZCjpIoNGU8q/MA9sVRWk6Xa6Vp8On2hkNvACI/VkeV6F i1C8hZiBXbfYbDbFUXiqXa3LdJbBYLQ3KuJBJIJIo/RAiYrJ+92PxgL7Vr0GKvLp49Zt4frMF1fv cxSFmllvtERE5VDOG+Pjt+yAoqfbChVvB5migjnjN9cTiIs8cd9oqpx9QcgkjqlU4qC3whar0JqS qimbWEl9OK8v1laRkSYXWhKP3cU7JwqrOTKwWgKfDxGwAaqqHnl1KO0SJ7zU3WVYwJVu9HB5Tuod y0bK6+nQ8+HwdSK4qmnl+810XAmaxvtUmgtBDPaNPpRRn5ikh4TD4yrkcqkcVpsdiqz/AE+e5ntE lubVrKYlgbZ2R2UKxC1aMsnxKA2x2rTAlEYq7FXYq7FXYq7FXYq7FVqyRsXVWDNGeLgEEqaBqHwN GBxVssoIBO56e+Kt4qoT31lbuEnuIonIqFd1U06VoTiqurBgGU1B3BHQjFXYqkZ8+eRwCT5i0wAG hP1y36/8HiqK0vzN5c1aWSHStVs9QmiHKWO1uIpmVSaVYRsxAxVMsVdiqleWy3VpPbPss8bRtUA7 OpU7Hr1xVhUX5ZvFCsaT6X8PKr/oW1BZjGqK7BWVeS0foBs1O2FV0v5bOZ1mim0oOKKzSaNbOxQj 94vJWQjm3xH3xVDr+WF3HFfxw3mnIbwIyy/om0JWRGWvw04srIJFo1aczTtirKP8HeUzu+i2DtTi SbWIihPIgAqaAsSaeJr1wKibDy/oenXU11p9hb2lxcIkc0kEaxlkjLMiniB0LsfpxVH4q7FXYqp3 NzbWttLdXUqQW0CNLPPKwRERByZ3ZqBVUCpJxV5T+ec9nN5fW4uq3+iSW6stpDczJFcB5BIXYQDi wUIjI7VA6/AOTGQYl5P+Xnl/yVrGu2kXl6bU9CvLxmtvrthfsssatAZq8/gFNlDLyLVNONQaOyOr 138pPNd7aeVtdtNcv7vW77y9qclqzBJLi7eF2VI241kkflL6lKsxAFK0AwFkGc6Z5vsNRuo7aKz1 GFpRyR7mxubdNq8gWlRQpWm4amBKeYq+cvOem+c5/MN7Ovme906wW4uWkRZrplRTqNzFCsaxyLxH AR1+E7bbDCxK3yBonnG/msdRu9el1O1eTT/Xs55rkRJfQXVve8o2l9T4SI/SqE/abvitPeprrX1U CS2toUd0jM0dw8jp6jBOSo0CKxHLucDJLb/zQNG85aH5ZGjXJs9eS59PXE4G3S7giMwgl+L1OckM Ujcm60HHn8ZjVTsolrdwiEBYrlmR4l2AfiZA4+hCD44qg/N/rf4du2hm+runpv63ZVSVWbkP2l4g 8lOzDY1GKvFF8ueZ10vTJrn8xbhtS1G3juhpEbL9ZCyw+t9iS7iLBaEcgN/DCqeaXo/mvy1rNtPd 6nc6orywmD61FwdQ13bQSBRJJJUtBcTJt+0V7kYoek3XnGxtrv6o9jqLTlBIojsp5FNYxJxDIpXk AaUJ67YEus/OemXWoxWAtdQhnmDsGnsbqKNRGKsXlaMIg3/aI/EYqn2KuxV2KuxV2KuxV2KuxVSu vrX1Wb6pwF1wb6uZa+n6lDw58d+NetMVYP5+0LzT5m/LvXdKvrW3S4ntBJbwWkkju89vO0wi3QbO kUQFN+RbtTCgvja78u6lbssps7q3KbxvEUuqcfeMpx+eGmLMPy/1S8svNnlo3kksoF7bvdTSymTc XCtty+yFj2oCfir1FKKHrP5d28M+rfmnbyxSzxDWYU9KC3S7k4pqV0FpC4ZWC8anbYbjcYGQZZom j+TbRZkvdFutQMnw/FobwBaABgFjiHLnt8qdsUvUcCXkEccOqazqel6rbyt9Yur63HFJVrELy5dH 9SMfuvgpxfku9KGtMLFF6VAnlrytpFvHaOmoNd6KdQ9RZGLTX99DbzM0z8g7oOXwhiUUKNl44q9O vIWmgKIQHBV0J6co2DqD7ErvgZJD5ls21IadNb3Q0zV9JujeWDXcDXEBla3mtXR4kkgMwMN0/ERy g8uJ3oVKqL8vaNb6dpWlaXa+qdO0W2itLN7gUmk9GIQK7gLHQhAa/CKk1oABVVBfmS1wPJmrCEV5 Wl0slOtDay8af89OOKvhjQrDU7q5trCyuhFJqA5JEkx+MIzijrFy4sOBor0NCCBRgcUl9NaL5xm1 PWVgugYp0vbe4e3ZlZUe71awQrCUPFoqpzDfzFq1I5MWLJfP8CT6rfer5ds9TWFEpPPp9/O7eogW gltopK0OxZfsj5GiqT29vbyuzjypp81vclTFLFpWpsCGSiNzMIVh/wACB44q9lj58F9SnqUHPj0r 3pXtgS3irsVdirsVdirsVdirsVdir59/N7ysuieYhd20XDTtUBljKgBEmX+9j+0zbk8xsB8VB9nJ gsJB47dk2F+rxH0zEy3Ns9B8NGqNj4HscDF7b+V2l3Oq6R551+a0uIdO8yams9iBbpdSOq3s0x4w uGVwvrBS1KA17qaBmE303yzp95dxW0P122YzArNL5ejiQSRM6KzO0XEL8XU9OtfiGKXrVlDcw2sU VzcG6nUUkuCqpzPjxXYYEvCvPSfmfpXmaWSxX6zp5vJpl1e6iuJlWCaQvHZJFYM9xxjDsPUkTp8K suwJYlAeWNT/ADIu4dIttTury2W11nSxdalJbTRwXkEd1ArQRtct9ZV5DPSRyio3HgOXxHFQ+isD J5jq001n5r1W8h0sSyrLBcMeWqIH9ABFlWOKGS3kYfCH4tuBQjxKGU+Ude8w6vPetf2lvb2ltIYY 2QXscrOArV4XdvbckKvTku1R37BKp+YWoQad5M1W9nAMMEQaRT+0Oajj9PTEK+H/AC7rqaJcSTNH JeywQyRWnKUrAkkj0aVY2CkjiBRSOvxdQKKS9e/JvUtL8yebtNgeVxc+o1w9s+5H1ZkuYyHHw8fU th8NNsKKeqeeDw8wXjxaLZX05ESiSfT5p5HLRbD1Y3ANOBqabDbscUKWja75u0+1W10nR4LbT45S Ira30u7RAGb4ukgHxMS1dh038VWa+W/MV/fhLbUNPura8Cs8k7W0kFsaOQqqZGYhuNK1+jbAlP8A FXYq7FXYq7FXYq7FXYq7FXYqxTWfyp/LvWXje+0O35RBlQwc7bZ+vL6u0XL6cbRQTXW/Ldhqfl9t DWOK3swIRFF6MckSLbyJJGohYenxX0wAKbYpYofyf0sxSRGa1KykE/7jbIdEZKbJQggj6BTxw2rK 9C0rV9PDpfas+pRcESFHgiiMfGtTWMDlUU6+GBXwD58nivvOHnC9s2LQXurXVwj0IJje8uGX76Kc Iayo/lGbhvzS8oqHYgazYGhO1BcpX8K4pfo1gZvK/M8/mFvMGpCzu7uJY3rFGkmq+jRYwxoIrF4z QpUpFKa7itTTCrKPKHmNmitdH1CO7OpcT/pD2980TfD6o53Fzb2/xcT+0AO1eW2BWUXNtb3VvLbX MazW86NHNE4DK6OOLKwPUEGhxV5R5t/IWXWdXe+sNdgs4JOTfVrvR9PvijPI8hWOVlhYJ8ewbk1a ksa4qzvy/wCRfL+iQ2ghhE93ZNI8V9LHDHNylL8iRbxwRDaVh8KDrvUknFUde+WfLd9O9xe6TZ3U 8nEySzW8UjsUoF5MyknjQUxVE2Gm6dp0Jg0+1hs4WYu0UEaxKWNAWKoAKmnXFUTirsVdirsVdirs VdirsVdirsVdirsVdirsVdir578zf84jWeo63qN7o/mT9EafqErT/o46fHMsReR5SkbLNAqorSsE UIKLQb0rhtiYq/5ef84naf5U82af5gvPMH6XXTpPXjs/qf1YGVRWJ/UWeQ/BIFelN6U6E42oi99w Mnk/ma88wW2v6w0P6Ue29VWiS3GrPFwEah1T0oGRWJFQIjTr36lD0Xy1O82g2TyCYSiPhMLkSrKJ EJWQH10jkI5A8WZRyFD0OBKZ4q7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq 7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7FXYq7 FXYq7FXYq7FXYq7FXYq7FXYq7FXYq//Z uuid:ee08319d-5737-7c46-9027-359435cb8a46 xmp.did:B2A91DB3863B68118083FE8EA4350157 xmp.did:262AE4B92A2068119109B20DE3399312 proof:pdf created xmp.iid:262AE4B92A2068119109B20DE3399312 2010-04-20T14:23:48-05:00 Adobe InDesign 6.0 saved xmp.iid:272AE4B92A2068119109B20DE3399312 2010-04-20T14:30:23-05:00 Adobe InDesign 6.0 / saved xmp.iid:282AE4B92A2068119109B20DE3399312 2010-04-20T14:30:23-05:00 Adobe InDesign 6.0 /metadata saved xmp.iid:292AE4B92A2068119109B20DE3399312 2010-04-20T14:41:32-05:00 Adobe InDesign 6.0 / saved xmp.iid:2A2AE4B92A2068119109B20DE3399312 2010-04-20T15:44:31-05:00 Adobe InDesign 6.0 / saved xmp.iid:2B2AE4B92A2068119109B20DE3399312 2010-04-20T16:09-05:00 Adobe InDesign 6.0 / saved xmp.iid:2C2AE4B92A2068119109B20DE3399312 2010-04-20T16:18:14-05:00 Adobe InDesign 6.0 / saved xmp.iid:2D2AE4B92A2068119109B20DE3399312 2010-04-20T16:23:23-05:00 Adobe InDesign 6.0 / saved xmp.iid:2E2AE4B92A2068119109B20DE3399312 2010-04-20T16:33:16-05:00 Adobe InDesign 6.0 / saved xmp.iid:0180117407206811A961CD1F56698B2B 2010-04-21T15:42:01-05:00 Adobe InDesign 6.0 /metadata saved xmp.iid:0280117407206811A961CD1F56698B2B 2010-04-21T15:42:01-05:00 Adobe InDesign 6.0 /;/metadata saved xmp.iid:0380117407206811A961CD1F56698B2B 2010-04-21T17:03:07-05:00 Adobe InDesign 6.0 / saved xmp.iid:0180117407206811A7BAE8E36BE63A1B 2010-04-22T08:36:47-05:00 Adobe InDesign 6.0 / saved xmp.iid:0280117407206811A7BAE8E36BE63A1B 2010-04-22T08:37:22-05:00 Adobe InDesign 6.0 / saved xmp.iid:0480117407206811A7BAE8E36BE63A1B 2010-04-22T08:55:32-05:00 Adobe InDesign 6.0 / saved xmp.iid:0580117407206811A7BAE8E36BE63A1B 2010-04-22T08:56:33-05:00 Adobe InDesign 6.0 / saved xmp.iid:0680117407206811A7BAE8E36BE63A1B 2010-04-22T09:03:37-05:00 Adobe InDesign 6.0 / saved xmp.iid:0780117407206811A7BAE8E36BE63A1B 2010-04-22T09:10:06-05:00 Adobe InDesign 6.0 / saved xmp.iid:0880117407206811A7BAE8E36BE63A1B 2010-04-22T09:15:42-05:00 Adobe InDesign 6.0 / saved xmp.iid:0980117407206811A7BAE8E36BE63A1B 2010-04-22T09:18:08-05:00 Adobe InDesign 6.0 / saved xmp.iid:0A80117407206811A7BAE8E36BE63A1B 2010-04-22T09:20:52-05:00 Adobe InDesign 6.0 / saved xmp.iid:EE29CCCA0D206811A7BAE8E36BE63A1B 2010-04-22T09:22:10-05:00 Adobe InDesign 6.0 / saved xmp.iid:EF29CCCA0D206811A7BAE8E36BE63A1B 2010-04-22T09:37:39-05:00 Adobe InDesign 6.0 / saved xmp.iid:F029CCCA0D206811A7BAE8E36BE63A1B 2010-04-22T09:43:46-05:00 Adobe InDesign 6.0 / saved xmp.iid:F129CCCA0D206811A7BAE8E36BE63A1B 2010-04-22T09:51:55-05:00 Adobe InDesign 6.0 / saved xmp.iid:F229CCCA0D206811A7BAE8E36BE63A1B 2010-04-22T09:53:34-05:00 Adobe InDesign 6.0 / saved xmp.iid:F329CCCA0D206811A7BAE8E36BE63A1B 2010-04-22T09:55:24-05:00 Adobe InDesign 6.0 / saved xmp.iid:F429CCCA0D206811A7BAE8E36BE63A1B 2010-04-22T09:58:06-05:00 Adobe InDesign 6.0 / saved xmp.iid:F529CCCA0D206811A7BAE8E36BE63A1B 2010-04-22T10:00:10-05:00 Adobe InDesign 6.0 / saved xmp.iid:F629CCCA0D206811A7BAE8E36BE63A1B 2010-04-22T10:01:41-05:00 Adobe InDesign 6.0 / saved xmp.iid:F729CCCA0D206811A7BAE8E36BE63A1B 2010-04-22T10:02:07-05:00 Adobe InDesign 6.0 / saved xmp.iid:F829CCCA0D206811A7BAE8E36BE63A1B 2010-04-22T10:03:10-05:00 Adobe InDesign 6.0 / saved xmp.iid:9383B9B27520681192B0BEE5D0BFCBD1 2010-04-23T12:35:18-05:00 Adobe InDesign 6.0 / saved xmp.iid:9483B9B27520681192B0BEE5D0BFCBD1 2010-04-23T12:35:39-05:00 Adobe InDesign 6.0 / saved xmp.iid:9583B9B27520681192B0BEE5D0BFCBD1 2010-04-23T12:35:54-05:00 Adobe InDesign 6.0 / saved xmp.iid:8FC2CD4E37206811A961FC16C5CD890B 2010-04-23T15:46:36-05:00 Adobe InDesign 6.0 / saved xmp.iid:90C2CD4E37206811A961FC16C5CD890B 2010-04-23T15:48:22-05:00 Adobe InDesign 6.0 / saved xmp.iid:91C2CD4E37206811A961FC16C5CD890B 2010-04-23T16:18:10-05:00 Adobe InDesign 6.0 / saved xmp.iid:92C2CD4E37206811A961FC16C5CD890B 2010-04-23T16:18:58-05:00 Adobe InDesign 6.0 / saved xmp.iid:DC437C8644206811A961FC16C5CD890B 2010-04-23T16:22:10-05:00 Adobe InDesign 6.0 / saved xmp.iid:018011740720681192B0EEE64D6C6C2C 2010-04-27T08:33:02-05:00 Adobe InDesign 6.0 /metadata saved xmp.iid:028011740720681192B0EEE64D6C6C2C 2010-04-27T08:33:02-05:00 Adobe InDesign 6.0 /;/metadata saved xmp.iid:038011740720681192B0EEE64D6C6C2C 2010-04-27T08:54:46-05:00 Adobe InDesign 6.0 / saved xmp.iid:048011740720681192B0EEE64D6C6C2C 2010-04-27T09:09:58-05:00 Adobe InDesign 6.0 / saved xmp.iid:058011740720681192B0EEE64D6C6C2C 2010-04-27T09:30:02-05:00 Adobe InDesign 6.0 / saved xmp.iid:068011740720681192B0EEE64D6C6C2C 2010-04-27T09:45:27-05:00 Adobe InDesign 6.0 / saved xmp.iid:078011740720681192B0EEE64D6C6C2C 2010-04-27T09:48:29-05:00 Adobe InDesign 6.0 / saved xmp.iid:088011740720681192B0EEE64D6C6C2C 2010-04-27T09:51:27-05:00 Adobe InDesign 6.0 / saved xmp.iid:0880117407206811AB08BB0454F8CA90 2010-04-28T10:03:02-05:00 Adobe InDesign 6.0 / saved xmp.iid:0980117407206811AB08BB0454F8CA90 2010-04-28T10:23:57-05:00 Adobe InDesign 6.0 / saved xmp.iid:0A80117407206811AB08BB0454F8CA90 2010-04-28T10:30:48-05:00 Adobe InDesign 6.0 / saved xmp.iid:3C22958214206811AB08BB0454F8CA90 2010-04-28T10:37:47-05:00 Adobe InDesign 6.0 / saved xmp.iid:3D22958214206811AB08BB0454F8CA90 2010-04-28T10:50:15-05:00 Adobe InDesign 6.0 / saved xmp.iid:3E22958214206811AB08BB0454F8CA90 2010-04-28T10:52:58-05:00 Adobe InDesign 6.0 / saved xmp.iid:3F22958214206811AB08BB0454F8CA90 2010-04-28T10:57:19-05:00 Adobe InDesign 6.0 /metadata saved xmp.iid:4022958214206811AB08BB0454F8CA90 2010-04-28T10:57:19-05:00 Adobe InDesign 6.0 /;/metadata saved xmp.iid:018011740720681192B08C0FC6D0EFA5 2010-04-29T09:14:04-05:00 Adobe InDesign 6.0 /metadata saved xmp.iid:028011740720681192B08C0FC6D0EFA5 2010-04-29T09:14:04-05:00 Adobe InDesign 6.0 /;/metadata saved xmp.iid:038011740720681192B08C0FC6D0EFA5 2010-04-29T09:58:54-05:00 Adobe InDesign 6.0 / saved xmp.iid:048011740720681192B08C0FC6D0EFA5 2010-04-29T10:04:48-05:00 Adobe InDesign 6.0 / saved xmp.iid:0580117407206811A961B481B5C101C4 2010-05-05T16:39:30-05:00 Adobe InDesign 6.0 / saved xmp.iid:0680117407206811A961B481B5C101C4 2010-05-05T16:42:23-05:00 Adobe InDesign 6.0 / saved xmp.iid:0780117407206811A961B481B5C101C4 2010-05-05T16:52:17-05:00 Adobe InDesign 6.0 / saved xmp.iid:0880117407206811A961B481B5C101C4 2010-05-05T16:54:15-05:00 Adobe InDesign 6.0 / saved xmp.iid:0980117407206811A961B481B5C101C4 2010-05-05T16:56:09-05:00 Adobe InDesign 6.0 / saved xmp.iid:0A80117407206811A961B481B5C101C4 2010-05-05T17:02:44-05:00 Adobe InDesign 6.0 / saved xmp.iid:C470125E21206811A961B481B5C101C4 2010-05-05T17:03:11-05:00 Adobe InDesign 6.0 /metadata saved xmp.iid:C570125E21206811A961B481B5C101C4 2010-05-05T17:03:11-05:00 Adobe InDesign 6.0 /;/metadata saved xmp.iid:018011740720681192B0E59BEF8E73A7 2010-05-06T08:08:39-05:00 Adobe InDesign 6.0 / saved xmp.iid:028011740720681192B0E59BEF8E73A7 2010-05-06T08:19:59-05:00 Adobe InDesign 6.0 / saved xmp.iid:3710CECB1520681192B0E59BEF8E73A7 2010-05-06T09:56:21-05:00 Adobe InDesign 6.0 / saved xmp.iid:3810CECB1520681192B0E59BEF8E73A7 2010-05-06T10:02:22-05:00 Adobe InDesign 6.0 / saved xmp.iid:3910CECB1520681192B0E59BEF8E73A7 2010-05-06T10:02:54-05:00 Adobe InDesign 6.0 / saved xmp.iid:3A10CECB1520681192B0E59BEF8E73A7 2010-05-06T10:05:06-05:00 Adobe InDesign 6.0 / saved xmp.iid:3B10CECB1520681192B0E59BEF8E73A7 2010-05-06T10:05:58-05:00 Adobe InDesign 6.0 / saved xmp.iid:48A1F95B1A20681192B0E59BEF8E73A7 2010-05-06T13:43:12-05:00 Adobe InDesign 6.0 /metadata saved xmp.iid:49A1F95B1A20681192B0E59BEF8E73A7 2010-05-06T13:43:12-05:00 Adobe InDesign 6.0 /;/metadata saved xmp.iid:4AA1F95B1A20681192B0E59BEF8E73A7 2010-05-06T13:47:13-05:00 Adobe InDesign 6.0 / saved xmp.iid:8764DA763720681192B0E59BEF8E73A7 2010-05-06T14:34:48-05:00 Adobe InDesign 6.0 / saved xmp.iid:8864DA763720681192B0E59BEF8E73A7 2010-05-06T14:49:03-05:00 Adobe InDesign 6.0 / saved xmp.iid:8964DA763720681192B0E59BEF8E73A7 2010-05-06T15:29:49-05:00 Adobe InDesign 6.0 /metadata saved xmp.iid:8A64DA763720681192B0E59BEF8E73A7 2010-05-06T15:29:49-05:00 Adobe InDesign 6.0 /;/metadata saved xmp.iid:8B64DA763720681192B0E59BEF8E73A7 2010-05-06T15:30:33-05:00 Adobe InDesign 6.0 / saved xmp.iid:68F61274072068118083EA8638B24501 2012-07-02T15:48:56-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:69F61274072068118083EA8638B24501 2012-07-02T15:48:56-05:00 Adobe InDesign 7.0 /metadata saved xmp.iid:A31B715B092068118083EA8638B24501 2012-07-02T16:02:34-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:8A53B0D13B206811822ABCD784B27385 2012-07-05T15:21:08-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:ED43EFD03D206811822ABCD784B27385 2012-07-05T15:35:25-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:A5330C943E206811822ABCD784B27385 2012-07-05T15:40:53-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:3604DD1A1C2068118083981798028F4F 2012-07-06T11:48:06-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:A7D1F155262068118083981798028F4F 2012-07-06T13:01:20-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:2F819854272068118083981798028F4F 2012-07-06T13:08:27-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:689D994F282068118083981798028F4F 2012-07-06T13:15:28-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:D8336E57282068118083981798028F4F 2012-07-06T13:15:41-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:F6548306382068118083981798028F4F 2012-07-06T15:07:57-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:D3A5DCC4382068118083981798028F4F 2012-07-06T15:13:16-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:AE4B7C7D07206811808381A34FF51DD6 2012-07-10T08:45:02-05:00 Adobe InDesign 7.0 /metadata saved xmp.iid:692896DF0C206811808381A34FF51DD6 2012-07-10T08:45:02-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:A70989610E206811808381A34FF51DD6 2012-07-10T08:55:49-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:8BF2C8D211206811808381A34FF51DD6 2012-07-10T09:20:28-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:E75A1D4A12206811808381A34FF51DD6 2012-07-10T09:23:48-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:7AC75ABA12206811808381A34FF51DD6 2012-07-10T09:26:56-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:DC5612740720681180838164A8AAF440 2012-07-11T12:26:48-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:E2E8B33A0D20681180838164A8AAF440 2012-07-11T13:08:08-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:473157FC1020681180838164A8AAF440 2012-07-11T13:35:02-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:1869B3621120681180838164A8AAF440 2012-07-11T13:37:53-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:F6765A371220681180838164A8AAF440 2012-07-11T13:43:50-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:F7765A371220681180838164A8AAF440 2012-07-11T13:44:07-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:C33048AE1220681180838164A8AAF440 2012-07-11T13:47:10-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:C43048AE1220681180838164A8AAF440 2012-07-11T13:47:15-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:06F600EB2820681180838164A8AAF440 2012-07-11T16:26:20-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:FCB10C3CAF20681180838164A8AAF440 2012-07-12T08:27:48-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:C3A4BB67AF20681180838164A8AAF440 2012-07-12T08:29:01-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:01801174072068118F62A3724919477F 2012-07-23T14:43:45-05:00 Adobe InDesign 7.0 /metadata saved xmp.iid:6BE51374072068118F62A3724919477F 2012-07-23T14:43:45-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:15013B3E092068118F62A3724919477F 2012-07-23T14:56:33-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:968312A7092068118F62A3724919477F 2012-07-23T14:59:29-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:7639E3340A2068118F62A3724919477F 2012-07-23T15:03:27-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:C25B039B0A2068118F62A3724919477F 2012-07-23T15:06:19-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:D7A362780F2068118F62A3724919477F 2012-07-23T15:41:08-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:E616EC80112068118083A73933AD1404 2012-07-26T10:11:04-05:00 Adobe InDesign 7.0 /metadata saved xmp.iid:F2C0EE80112068118083A73933AD1404 2012-07-26T10:11:04-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:C67EB265122068118083A73933AD1404 2012-07-26T10:17:28-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:3FA2EDE8142068118083A73933AD1404 2012-07-26T10:35:27-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:C57C55091C2068118083A73933AD1404 2012-07-26T11:26:28-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:F7A50AD82C2068118083A73933AD1404 2012-07-26T13:26:46-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:78076B5B2D2068118083A73933AD1404 2012-07-26T13:30:27-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:F03B87F2352068118083A73933AD1404 2012-07-26T14:31:56-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:E6037BDF362068118083A73933AD1404 2012-07-26T14:38:33-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:311AF155C52068118083D6FE240ED774 2012-07-27T14:36:58-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:CEF57A60C52068118083D6FE240ED774 2012-07-27T14:37:15-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:4CAA4CFEC52068118083D6FE240ED774 2012-07-27T14:41:40-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:F735DB04C62068118083D6FE240ED774 2012-07-27T14:41:51-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:9E34D95EC62068118083D6FE240ED774 2012-07-27T14:44:22-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:69B6894CCA2068118083D6FE240ED774 2012-07-27T15:12:29-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:7B50FDDDCA2068118083D6FE240ED774 2012-07-27T15:16:33-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:7C50FDDDCA2068118083D6FE240ED774 2012-07-27T15:17:01-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:793E810DCB2068118083D6FE240ED774 2012-07-27T15:17:53-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:5640A640EC206811822AA1B9B0237A3E 2012-08-09T10:19:08-05:00 Adobe InDesign 7.0 /metadata saved xmp.iid:DC3987C172216811822AA1B9B0237A3E 2012-08-09T10:19:08-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:08B298E078216811822AA1B9B0237A3E 2012-08-09T11:02:57-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:C35F89CE79216811822AA1B9B0237A3E 2012-08-09T11:09:36-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:C45F89CE79216811822AA1B9B0237A3E 2012-08-09T11:29:46-05:00 Adobe InDesign 7.0 /metadata saved xmp.iid:E027DE9F7C216811822AA1B9B0237A3E 2012-08-09T11:29:47-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:BA9C375C7D216811822AA1B9B0237A3E 2012-08-09T11:35:02-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:A9DC55DD7E216811822AA1B9B0237A3E 2012-08-09T11:45:49-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:791F4C5C7F216811822AA1B9B0237A3E 2012-08-09T11:49:22-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:7A1F4C5C7F216811822AA1B9B0237A3E 2012-08-09T13:19:09-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:8A2A92B68D216811822AA1B9B0237A3E 2012-08-09T13:32:06-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:47121BCF8F216811822AA1B9B0237A3E 2012-08-09T13:47:06-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:7BCCF2D78F216811822AA1B9B0237A3E 2012-08-09T13:47:21-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:4213B4662D2068118083A15E2BFF64FA 2012-08-13T12:58:53-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:DA7BE9722D2068118083A15E2BFF64FA 2012-08-13T12:59:13-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:2DE2AEF3342068118083A15E2BFF64FA 2012-08-13T13:52:56-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:03691060382068118083A15E2BFF64FA 2012-08-13T14:17:26-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:04691060382068118083A15E2BFF64FA 2012-08-13T14:18:13-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:05691060382068118083A15E2BFF64FA 2012-08-13T14:18:36-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:06691060382068118083A15E2BFF64FA 2012-08-13T14:19:21-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:07691060382068118083A15E2BFF64FA 2012-08-13T14:33:03-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:FD5573963A2068118083A15E2BFF64FA 2012-08-13T14:33:16-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:3A1BD5383B2068118083A15E2BFF64FA 2012-08-13T14:37:49-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:2E1463633C2068118083A15E2BFF64FA 2012-08-13T14:46:10-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:2F1463633C2068118083A15E2BFF64FA 2012-08-13T15:00:40-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:3FE73005472068118083A15E2BFF64FA 2012-08-13T16:02:16-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:21EB5D0C472068118083A15E2BFF64FA 2012-08-13T16:02:28-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:36A3AB6C4B2068118083A15E2BFF64FA 2012-08-13T16:33:48-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:A953EA924C2068118083A15E2BFF64FA 2012-08-13T16:42:01-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:4A32E25D4D2068118083A15E2BFF64FA 2012-08-13T16:47:42-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:EECF1274072068118083ECD078ACDDA3 2012-08-16T08:40:28-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:335E078B072068118083ECD078ACDDA3 2012-08-16T08:41:07-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:4946EFA5152068118083ECD078ACDDA3 2012-08-16T10:22:05-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:0134339A07206811822ACA443DC0A442 2012-09-06T09:30:20-05:00 Adobe InDesign 7.0 /metadata saved xmp.iid:5A9461A70F206811822ACA443DC0A442 2012-09-06T09:30:20-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:4B9B35B50F206811822ACA443DC0A442 2012-09-06T09:30:43-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:8D228A5D38206811822ACA443DC0A442 2012-09-06T14:21:45-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:22197ACA38206811822ACA443DC0A442 2012-09-06T14:24:48-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:850894B448206811822ACA443DC0A442 2012-09-06T16:18:43-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:6655D14049206811822ACA443DC0A442 2012-09-06T16:22:38-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:263DAC5749206811822ACA443DC0A442 2012-09-06T16:23:17-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:583214740720681188C6A0350E35971B 2012-09-07T11:05:37-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:033DF09D0720681188C6A0350E35971B 2012-09-07T11:06:47-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:1E9D1EE4072068118083D361C8BE6452 2012-09-11T15:53:40-05:00 Adobe InDesign 7.0 /metadata saved xmp.iid:77CFD113232068118083D361C8BE6452 2012-09-11T15:53:40-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:075F729F252068118083D361C8BE6452 2012-09-11T16:11:53-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:A80C849D132068118083C5471EB6AF20 2012-09-18T14:25:42-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:0E13F99E9D2068118083DF3EEF97D6F3 2012-09-21T11:51:43-05:00 Adobe InDesign 7.0 /metadata saved xmp.iid:4765AC7DAA2068118083DF3EEF97D6F3 2012-09-21T11:51:43-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:C3246D6F182068118C14DBCBCF612D5E 2012-09-21T15:55:42-05:00 Adobe InDesign 7.0 /metadata saved xmp.iid:6C881206452068118C14DBCBCF612D5E 2012-09-21T15:55:42-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:A908DC82642268118C14DBCBCF612D5E 2012-09-24T08:46:20-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:EFE5335C682268118C14DBCBCF612D5E 2012-09-24T09:13:54-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:2EBD60B2102368118083DF3EEF97D6F3 2012-09-24T13:49:35-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:B66726F4102368118083DF3EEF97D6F3 2012-09-24T13:51:25-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:B76726F4102368118083DF3EEF97D6F3 2012-09-25T15:17:51-05:00 Adobe InDesign 7.0 /metadata saved xmp.iid:5645BF32E62368118083DF3EEF97D6F3 2012-09-25T15:17:51-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:3F3DA941E62368118083DF3EEF97D6F3 2012-09-25T15:18:16-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:354F4F7F872468118083DF3EEF97D6F3 2012-09-26T10:32:26-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:364F4F7F872468118083DF3EEF97D6F3 2012-09-26T10:39:39-05:00 Adobe InDesign 7.0 /metadata saved xmp.iid:79FF8A81882468118083DF3EEF97D6F3 2012-09-26T10:39:39-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:99BEAC6CCE206811808397F24B8D410A 2012-10-04T10:43:50-05:00 Adobe InDesign 7.0 /metadata saved xmp.iid:C7BEE8F364216811808397F24B8D410A 2012-10-04T10:43:50-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:74F8518F65216811808397F24B8D410A 2012-10-04T10:48:11-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:0180117407206811808392F3BCE74A17 2012-10-08T15:54:50-05:00 Adobe InDesign 7.0 /metadata saved xmp.iid:43C9137407206811808392F3BCE74A17 2012-10-08T15:54:50-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:400CEC8A0D206811808392F3BCE74A17 2012-10-08T16:38:25-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:6AD71274072068118083E131A06D39A9 2012-10-09T09:48-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:DC12C9B4072068118083E131A06D39A9 2012-10-09T09:49:48-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:A7AEC246092068118083E131A06D39A9 2012-10-09T10:01:03-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:EB6CE953092068118083E131A06D39A9 2012-10-09T10:01:25-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:132D4B440A2068118083E131A06D39A9 2012-10-09T10:08:08-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:224F58720A2068118083E131A06D39A9 2012-10-09T10:09:25-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:5C70756AFB2068118083E131A06D39A9 2012-10-10T14:54:18-05:00 Adobe InDesign 7.0 /metadata saved xmp.iid:90B6776AFB2068118083E131A06D39A9 2012-10-10T14:54:18-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:E44881A1FB2068118083E131A06D39A9 2012-10-10T14:55:50-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:6DC13628072168118083E131A06D39A9 2012-10-10T16:18:20-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:CD60163F962168118083E131A06D39A9 2012-10-11T09:22:35-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:4465F861C42168118083E131A06D39A9 2012-10-11T14:52:50-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:83C61C06782268118083E131A06D39A9 2012-10-12T12:37:50-05:00 Adobe InDesign 7.0 /metadata saved xmp.iid:38198DB17A2268118083E131A06D39A9 2012-10-12T12:37:50-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:38E1127407206811822AB50E799DBD69 2012-10-16T08:52:22-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:2CA37E8807206811822AB50E799DBD69 2012-10-16T08:52:56-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:F90C07431D206811822AE0EEDAC2DFF6 2012-10-17T14:44:31-05:00 Adobe InDesign 7.0 /;/metadata saved xmp.iid:FE7F117407206811822A990AC415CBD0 2012-10-17T15:13:12-05:00 Adobe Illustrator CS5 / converted from application/postscript to application/vnd.adobe.illustrator saved xmp.iid:2340425B0A206811822A990AC415CBD0 2012-10-17T15:27:44-05:00 Adobe Illustrator CS5 / saved xmp.iid:B2A91DB3863B68118083FE8EA4350157 2013-02-28T08:48:01-06:00 Adobe Illustrator CS5 / uuid:609d373b-b53c-f546-9e9e-50558d6f1114 xmp.did:2340425B0A206811822A990AC415CBD0 xmp.did:262AE4B92A2068119109B20DE3399312 proof:pdf 3702 application/pdf Model No. 5423 Wall Mount Lock Box Instruction Sheet The Master Lock Company Adobe PDF library 9.90 False 1 True True 8.500000 11.000000 Inches Cyan Magenta Yellow Black Default Swatch Group 0 endstream endobj 9 0 obj << /Filter [/FlateDecode] /Length 23289 >> stream HWˎWLY05`X{=khu0$ӒeI^0tdd~]\]RZE$%JK]{˯?]qo~6,RҖU-.I^C ;]_.oq3]T2:9(%ɚb]j_-[ZSҚ⚵ECw,0 <%Q+c/OJ?p=DoaH_>!7BW 9RFfd}&BW. |j Òi>(QLk-TBEuDWeyҵ ڷV`}m,/"!m-eqg=l 2t%nf &^}5X6GK㻯8+[tǼPqX@;ZO# |>aLe[8sl˻%%"%"?RH- }GXf R$[68(n^ٸ\3s(k͸dkHɩWDV cFΖLBncEX|fT&hno 䆷 ݡ VƴC,ggłN1H @Xv䆁q:(d5G\ln`8p VMko*Ǔ.NIYQ(wIs^@}W`aeQ#Qr '`tWb!I(ZЦ> KM+bK!Jj,f)K7v2Bmgj%(RvWx,YȌ0 FL)U=(;cYCl|MF˾v&= ab4ӂ 5.a:Wg38(<-[<淋Oq۠k]"c/0ԙ7[3vZ~c[y|l9K< PTal$|g?,Nœī+R?iu4^O5^r4cp'!~4VJA''GW"ov{W?Q㵏hxx4^2D㕣+gW5^ƫ'W>WճkIG|E5TebV0Q&V2 )aVyJ@6!fY)ۥLbla0$EIOʀ +W9`/m Kp21-DZ=hvlQ$E<NU' y2š̂c>8}!0x\2;S &d"ygvwDٽ {Hk&o_.)7}ʃ{&jRP ^ib,د [bmrwW_Nx$,~LHWL\Yn|zаlNyՐ1^%$eiR Ebig>XNIU,$X,[lÑ`/,;QЈ{ʚSm^Z[,M"sCT&Wu|yecL\vg!*JrުƽI ފu(&Tzr| Ո6`HH[=c$z ‌TlV~Bc@D|.2.>PQ. y˧l!Sbam}^`]+\i'jhg~ i.ԉ\HcWEu:ehHd!7 4xݬNm).κeay aE+^))# QWr;U_&0"ikÔSndžVC+,2=&F>~#Ti3'۪N۳aG%ܩ ^iX`~WC;$ýa4AU #Z~ l \ Fq߫j?ʪƛ;RWնr:&$ATa X8fاQP7uUW)ڎ90ҵVY߿XD|jq~({)GIˆ/v)rPY!F@ .FQtlx+wƈ'men O~%<i7Y;zԠs>}c^!݃޺IEsb}^W3ߋĶmß[FD6D՟&7{ fY.s8Rٔ7q86^ 1&AM߆\=@kO |sWBSOa55v1;KSuwiwU+'gi絛{Z@  Α)' }cqz ocw[<Ҵ SdN l,Uyqk+ķoU?H\)IU)g|> t?A!46^jKFhI.qʧy 'b3Պ]H7ZI9"xo8'x0/ |Z26.7jbHb1캱TKHK7UFpY#O>b9,y^ q]8랈=o: [j INs/n("aAOb#p:0H"q~|]vÅ< fQc@3e(`J]2xһ/t<+ࣙQF q%-B_/O]=>t *KucE4!)o0Z5%Ug0z"ތxVd h˶c|>y8|0ܸN48 !N2`)xl 2섋2Pt4j+s@KDg}t$9Qz@c*lz3voHۤ4=`8vNڪM2o L 8)LIΩЗ6Jic+;5U|>XCn7_"8{ŊK2TIl$N&7YX @EBڛvO̰)m[ P3\ D*ƚ4u6u Hasx $YT;Nn2k04~iMA@)bz0TLt޶ρl[% qX oNn 2Msv2)bT &5FNN̴:\fV({4vX)cs.aT /v!>$t0OTڑ8Z6dy1qKif*̧$(gi|ySCRR+Stk*!/3`" [@T*pnEUA$#,f.bE-t527y vu,&6{6"#2Td0Jr"aCe2!qZcc,%:i5d CX[%օ;YRp<6ǑڿC@zi[4;(I~ m~>-^o-(s LyC^8ʎQ ›.5Q\h"C rfͷ|p<ЩS0z?Aa jFvZ!'ت/Xfn7j^|+I]EȢvTWcKQd*]x"x(PG Nm0֒\V% t ҌctHtkW7Xivi<'c(uPp:'SF5YTCcPǟ<^Ls6߇q =eH :v[a\ťy!dQMe89| SP,DZTMLǁ]oJ;8g_𿦋h)ؓ&(_ )눎7{xs+FC,~㎩_^-;F_?0|?6 }{ðI5=+0#LfDJ+yPC0+~ "Hi@J*(p)ξ*[Bu`WpQW0ē[s1pЯwiД'x(#]ힷ$o{Spr4_(xp)VɜJ1TB_қ(.BVb_'c<毘ĉۖcK:uGs} czD)I /쑎6*Xҫ@zkl[› qn6fn~ C1Ǔ/|,r1"YLR/~BKFi^S1ɹWo/qX5Y_bLњ3k}VSռ&PXneHʪ)9Q,vւijCUQ[[q,tމ5KZ E8.ʵ61}P =MX5K A7?u}ͮC+~0~SynA[_5*#È6 lS[Fxwh#٬\N伈t(]E7r)s̀OQyhR'vg NA]dLRV"%ę} J$h-iC'`ՇE<ҁXS-FrKXCmX^V t>U,e?HvwW`4[vu`b } (t|*$)"$lz;&d j[fv22-ivZ`cR 6,\fb@s9 H,aIaa8,BYX͂6,H5GU!Z'w~8V[*MDZpb8!$cK3V$ >nqo3xa\DkV0X eev1p )y27ڗp{: y֒m5 =xoܿ|ݿz/ NZo%0NBH/%V Z ,2a*qy# 7_H{onBȂ;2S s1)Gd2 " -:5p bc LiJ! `̋͘/+Xyz?XyI6q\fa-_ 퓦)]\ F8aL13ŵ˽IӰމ"gȂލ3m")-5,yӰ ڟ )xaAQ{Om=xLF\扑klF.c3g =~ܮV(߶QBA%q hĢܨi(~\ղEuY^ [ma-'94nLYjxϚUP{}bi֓moφo l+u{^ZD-Mq[*W*\Nc ظ5ł5ڪ055I{ē8 ǚއW^ O}!m Ÿynx,<=3spGnYZφ4X7ro&aͫaṠ2c a-912j9,^C@jeՒ57[Gkw 6g()=43 G盍 #f/ < v%hZGW,W%9)29e f_Z~QǙ*8WϷ1RC}KlVQxO_cf<ߖ+Êcyw9XSW#!+A "4P&4p;f D<ľ&N4Wض3\Q_9xVn|fM8 TC؇h]zy*u>O9(R 'A4SKGD;"*ՍUG6-H (?U߭KFgBE@#ԏ8ƈi phW0'<<=Ή%g}B,$7,u6<~hGQǜˣE=2@GQxzISjMLV3c")\!4!pGrx>?}U!-]gu7o+y"Hy Opq;<Gj0AU @#mzglh4&6y=|9mI* IT^2 SlƮ+):޽l Ly.Zr.nہU%T>H$rRk歐1 j3ڼ k @5MQ|5Zlaa3&D'<Dvz73eUV˺ޣo]Afpfe7YO B169dբ*DZa}Kooz®+;vLͣd~_cgXfnCŭ>| NqƶGl@`"*,K3D %eJI80%1s4n Ni/jn#$8MuAvP.]oi)!,Sl鶅=X4n,B}ʋUyOOV B{-C%/+^Ϸ}W:\,ߞh:%a]7"ɰ7!jUŵxt~x*l>Czs*#C |0-Vm {P+T܈gCw-aCʘ3f1뺃zV=q8EE_pF?apJTsyQCWjfVCPhmd@(“UVkʔi ո /]X)o]ucQLN!+g8GU.qG!y_myNuɅї\_To=RRgNQ-H[&8,1,c_|+n)Jys~wI)!/I͞w-QC]:L[cV CQ468fGU"!0Nf}H.2I~7%Y12to ox]to,g o =˥g@M5M,4M$CJAu_qm+vY8>(!&O%Wn# @?s^U$d OhrZe;gkb秗S{RSLDmww#^?dft?c7HBel;r0#4s]7Q]Wgi J=}niu֝yh +{K_ cHJ%$E""3xm"GwwT7G0;X:tRujJqfsgk3k`"ySlVW{igH?T -cPjK8p ]HK[-zHO-`VZ-MoLwܫ.@WJSU@ey02Ob?8'rCw,rʻY=˺PU Ob Jz|э)Vw8Ӊ'# 7Ъ;%TLPXc2_Y}f6 ƘcQb4Xf"3!C\`qv"glFb=W2Qð,le꬧!8M&jv-a\MqcE9saUd5+mVGĥo=­D[,q,=Zm>)@ Us -x@;jU3X@az:%Fnsjjzm WFQ+#>v23Z@,vZel52祌Y`z@'ޞ^9NB9D({O `-H>kF{ez, r<_,Ge&byK]@xʶ7ԁD{z؅f#3.VYPFrhlOXJF"e Y|ȬX`!3Rړus9x8rF!?# .cU(`F;P(+;9B"DUWw=,H{?=͆;}축 [!ҊaWҊ^= ߠy{)ܻ զi!:Upצ1*ZPV*MϬTG Rt԰5Z$NPԹ*GI3TxP)/I 1:ɰy1;^ z7s6|5K=O;.H)c† Ch+ `)Tb,wr[=KnZzuୠ~hs%vb=>ػqChrQifW1p`j >Xb,fG TmmzG ^45a 3rNPWH6Ҹ6L`/Dѥ?> oR{g]橗8'nSL ը~L)NɮC9xߤoCTv+QD>=6 ;g( mϴl;P2[P$˨Jp?BԖh#^/$#@l-^F$:t"8d|Dstur⯩[\ Ȧ9?["*aƢok-Zq50CSɊ/aZrqN*?nk/A{Qv'3=LBY =I(2H^J]ŖnFp/0P(hv +DSLew|<7Y}L?5ǵW 7'd8zI 7K'xIC>T" 7ɸ7/L/>8՘[îG1KVk"O=kL,ByMbNCتnj P#+2||[NͶazϬĬJK)iLxX,hCptB PkL'mkb-*0yk!7vKL#4 j $6mbM!ܿF 78ͱDep'>{Y3q |R($mmB 胯Ov]UubC#dJ@a XEYHRykuSFӟEldrR f<Үp>{h:xS9u6:q`lŲ~H f@s)9ka,d%8kLjĪgJ#.]#cishAei-4Z@--6YGskR(q" aP>kr?j:7'~N0x YJl6ʱDgv}-;"qt1UWU JxV{ʀQBM&XHiTuC%erRu% *1(S9dr2˒6RyU^鳊=v囕zBEnRlGu^ΊYV@1+@N֬5= ~+<|M c2ҸdU8xbL҈mc?2r('S'هqKd##lM#1im?zyY ~3*a2HqRa2BMt3IaO/Ԇ]YٍjNm8\hUn/m1J&cVcwyxl^|{mH blON\ SL:+dtx=,^jAe $b/xu/tZ&|ie ,k9͙q g+s{l nTʯ:UtȲP6ʜ4Sx*=|=qe^uo] D?^|Ū>˟^LQSj@SJO n[hbBzۿ%_~q[ :OXcKbBi_V8EP?q Ką@ 6~-w%Xx %+nF# &:ѫqQ]`6Q!0- NC '[:=kb]&`dW8gMaS+:vF"4ĐV'1E )vzS)tl_j]ЧVYU 1z6اAh`ߗ_sՉ#i7`Dc-HO4$)eeG}!)> qCk8LQaLߪ-f{b|Mgھ2s 'fcZX$Pdb(Fk 1z4 R$#|)eȯT acא ҃ë+P]cٚ[-A1d(=}<MW*d6۟ x:m4C]3Y8'Σ&<͂=75zaqIy6h&Meh-&O$w]M&ʹ?qkf9de}L^̙cꉇ[{xp|O΃^qET]"ufVodƒV"\Q~' v>7èmY5ØqnSYpRС4e aWpO :_)!h3aP̛8f'6ˮV̯ xJ9PS`qk[c j}^~ԺU٭c1͕*N~6(Jjj evπ<3m³)GՑ7Tt\1@kQ]c1=9S2#CpVZk9mXgRO+b =b^wf]w3N6fzv>'eӾe4ƌ>2t3 UckA(*+h_aƊĘDk')-l30M0O 켉G}T[y|$7Kx^$ y߮;w} K\Q9>&#J棶qH掲Xk?a:6& R۸ ak~l!ll EE9,%wwV{ ?PX;[S5Pd<|F7C))elyޓLN7* qD+)\ y#:+JZ XmSe\~^н֧cKඹ.Hq@Va!tdXwf,(M\.k=H9s(äFX|!ׅJbeVd .~1em˷#$Tf -`q$6N^n@C Q͡!XNUj 2!=(" bJ丑]؆}yM:Q0$U!Mcæneeeͷ-wTk(>:W!6c8ھH:3# e  Wk$Lu(x'heq:0^{v_7o4I8[% r8醡E14!הΣh gK4)) jJJ>eSx=K:Ny^p3K#=Sp-XHW{?e#l*zCj߲ש>pLʫ+~̜J5chVn,d~=)!ߏ{m1n.>nG4ݪ =V,z6 ym~GY5h k ϣPj0?`;E^0΍Ga;&{mG3 @.Fܿ{wE)1ƛ?&O>bGJ"ɬ9谂ERbJ=AUס02l)dyOIlUΠpb,QhZgF+l]G($8:cwXĿ@A^@Nt`st Ic\l~5U*̾"nWYG 3'p{ge *ևlMp4+wq wZM U7yC'}h__KXO?jḇN G S#abA_78ruk^+QaFf 3v3*y5\8ySIlw1lCV ՜JYyǢÙF%i6hE냰7\Gv(u?\ ƭt+M3@dksO 0#9N% }o场(IڬfNp.2=AT'l׆WR/E-W\9\ 476efp߷zw3__-gDեGq-8H8KSAM6e Cy w:֓Cd7t=?n<2qfR /gʚ|(͞ 0e)_ kQGNqd 90魑XvݕA2>\#57m99JTo4Y%Y5qT!$1EV,e"*\_D /ՋQU(Gy Uk搶 Ga[/|s汀6MmO.vPz& ㄼ\w1S^v/',zЏ4G9K9>h9G屾7H 犓kl03Ghq$ "/xj!EdpC#Kiec]lJ|kw\U۱936xcñ-gam'L_ b:FQtMaH$b֬x-), ۈŏu 0=?h,*qOzU :Eɦ/ZkQP|=m/nu:jQc9IfxBLv?u#4egK 4JSGq0aiɡ3bW_5F[N!4~lβV>[$JCWc ]̜-0sG.Lr ;O"tӿ7!VRӝ^s!1 F^2cH2T{k<-A^p3˾P7F5пm8L\jp\j؋(6#W18pPqh'jCPtT W]CO@.xv  ,Vn`2vpst$*jh{$:5u U&iK~g&;ЬGOÕ#J&0Xim2Dd}.Q9ǁnΞ11WW&؂3'6ٓL]K&1gL7-AeRڇNڮ^Z34|{5o[^;Vac,Ob.jal\0Sgj!̞qn%Mr mP̕)j U A++&HVwJ7Yh3pB^mtm̞D}5=aMV3T>uT7 z?m7GHFV^M'Z1bAHQ}֩x ֘"e=^2U}iO^q{KɫɃ2X_W^n{9?o9.AbOw#7D6ⱻCUL#2^dmI?a)s؉sN*H&hF%&bW?G uΦjrޠ$[ԦI"e ztEλ1Rg\(=Kz\0swn Ϣ@ߗB UE]I(Q?mS]PUZVzjBeMoRAK$'oaPZpʃ.A( Su>e9AWJ&rAKN3Nc!>\EN!r(Bo9@gYi4%JOC44?N [y6n unLб-07[S{˪6$lj$a%fRr%:!39jZ]FU0uK J2>m /<kۿCGIvZ d93 dEUDDrՃvY\UMuWҭ==ANiPnHJނ|SIXƾ|Ϥ]2zز:3T]Ȳ`C4XٲiRxpv~^rO__7cBo+#\Wm^0r߇wbΡH,]=eD\H0[?>TsmG:.|i\]YKr^ 0k-2?_tilWE9տ%j#Zk0j׎`BK*:,ϟs;dL%%>YSرkKFb[ߣH7ڶPa" A v8 H tz1u XeDдMrfVݹmB&_pnֹm#gƭmX|XfV`ucu.LTg&3o4<'5w$@IagI@gk)t, |Í$v".SL,젳=%۴{g*n }B}kZF86.s@WvF-+): >3qd[镴0k(;jzt[͂UIS #%fPxq b]LKZhƓƺ ٛh1Tc}1Si`'L-⛶`¥9W"J@!MdReQDԖYE}@r;e)H7Cl=7Uwګn'Z<\>ϝ<4.^x)q⪦P=foHg)>8E>v:J< )i(e=n'ٟ*z e'|M9J^V:]_W^n{9?on&(|D}Y;dq`ݺuRPu)Lgw#.ꊙZR1oڋi/^|wq,۵嶽wE>b}(o//_/Mo~;/8[֙ EHe9`aXsH|q#'ŗђI)d2 b2d{6ʯn7]٬JXxB4FnT;6aY`wjn37! >2zBD~̤]G퍙Cʞr̚r?e`Y߫yz"z1a1x&c}ܨ#8yWվgS֦L~ ;udGLr2+K>,UbN+rkϚ].ح  غFgf fDL@nwIXm939"agvn!7 iD׈qkNb `M$a?aE5Ggw\fE͝[r9kxTrxIC\ʊ &sj,w}]!O-,92ĜCLx8|A|pq؞{ls&/K3JQΪF8]6ԁ$<#@IdolMhaL" iV)pOX1 UQ$"d% j8BFYX$:ovAgH`l#Y^b0C) 6b+ّ=;#K(<p憳n׏k])4 d~KHnMx|I“`njm{GEEaaa>ګ=:e, h:nLVw8qUcg٣jm֝H'׍% hvV }Ĝ_-KTgz061gmzQYy壋b1ez:4XliP"$1G iV@WuW@aZ+aU21!P?dN|a?H&1y wd T2골ʝ*Ƨ*E @NvUʪߠn_IGEePY~ʌ+.i'G E4L9ͦ;*4'x =WvJZjɑe&}!n3t>|9Ѳk=&__O;~1'JI;uErq<*5`}U> stream HWIne d2c B7zZ0#H{*UUmQRrxQO}Qxn-x//ۖxC}ARO]xCdPjJhׄ:p̑}ms?5Aj=],*ܰ}~jmT4L^ioL۟ק='^-{%xÇ!%iM )&TT{.=Mpgw LsOiT*pwURIY.NUh ?٣ch" 1Kq+|iR rВv6t/PWWlMBZ{<h=eBӱ]ž#Oz4ah09Q*U2s*=વ="Pfߋ="ςGي pl_P5EU9f+_Q0x2.B2Bkޢz[ųUWt.p=Vow=_;\ȵ.Pو֑۴;!DPX:h\Ř8X;D#a^9"b7|/dG<~ EO8z_(Yt.&7v[NaܰK#S=]"^a0}tFUOEd^w^L*ьNj\2B4tR者cuT 1I4C}Ѳh1jq@4sF,Z?z:O}?h53U3'Z2AXrXF;2t/wcxڊW.uf9R3{j"rD),=sJA3*X!"Z!vwv>73E:2)^ޝ)CD~[R{D^{Һ{^\2ny^oy9K;yn r{jO 0b"W0#Ln ̭ff_ucݸs?7t2E}0Gʰ@b7->z#̫2ǁ̵IQ6D&]_ry=ȧLf'_}r'(L=2gZ, HE9`1E6o!TMxO[j)cSejC 7m@x-f{xIFO;HxӅU׼9"M>1(O('L.0zƀԧH &ݸ [y>oU7å~ƽ6GQjc jY X,G:UYpm(`+-LLV`ylO Ȥk.alvQV]J9-˺17Lr5e\1L_Ҝ@ ]{Sܕww}_mmП:343e:n9Zd[a>krldCDI3\;8R޻4.;PZerA]*Z׽l=˳ۍ ̮lkN^QzW"@/ܸ>LwP@tő3xN9hEf{erv-@w7w./>(=Tc= tpqp~F $Ηfefm-քc.h44Qz.izO[2F+#.*^[5}t;i H@={j倅c kD4}6w~{iP_.ꀘ]5@``~= B֫"q8\y+CÂZIDĔAbVƆWVnN&lgLaie\~zK(!:!? `L2"c*C\?⯒ oKcJsVZ:VZ`&2lP[W̱7s ]5Xr.1ڵ;KXᜃFhѬٗZO:CƥF9n&F+l{ bQ| Yő R@#!pz 2(pJ}rݲ:e9߶jk-V|v%Zmrԭ xhN6)S x8,>6RMW%{ T !h-`:qz\30ͿTIq27J]Qf?H(XԥJ^Ji*ו$M;@F]45+XU ERۛm%Ge$|=vz+ZT Z 2_-gه jVYD7>gy cvg,GzRn>4nQƷIЫP}VEA1`%pqF==FMr` Oj5*:m+CQǟٙ9 iA~x;BɻO!x()/@T>vQb 3*3EԨl< 01$pil& Ux$?ݼIvX̋p0;µ{Cc8L^LNS|k5Q9 $H1C!62䧾%c>gcrh{ôi{$:*4bZrJ 4Y4< _Yl 0V WABM& KJbY@ vZ֍q,MZȃ,Ȓb#zGHy傕oYNbH P*0i.Zʧz}|β5:H5H}xI=95zTvڮly=\,w Gf {O(U6CE$JgFӖ#+&&UF#=L Lq{D Tgo!i!4>mN zwh.Sx߇\;D_$\|cs~&aW1FT#ZQ\ZIAD ~OD.ڢRQu"ݚT7ƅՋk)LUe,2lx!6{U%+gU8lإtD\`26ͻxNE#3W dn R/Rp\?P7)݌I1RK.t+n74e c]Oejұ >kz$Dlcf9N8x4(,=ģryrtG0SŎ(%3'F5FGX&)J;D*PH6%(BZ@"t?SꟺI bk::V=‹-)m D,m/nx#>#)o qch4ZBɩXuQQ-辅kN,ͩCBZ=ҚkPm\q܅?! r&'#yFx*4 AYT,G8ɢجFd( 1<ؐ8ti}=e2g\{<ऐE^3,=ZHdpԫS*uQob*4^̺d}0 3M(TKr̚ß^町FMYB4F5u#*3vs^)~een9+Hn]Q=]s2f^ Us_BzO"\ZLVȓfGC:OB-yu3D FPgZrGac&K,3.Sv68tP,`%>c2!mL# ؔe8r[zn\ygI|HєÌA[4 `-!=nGLϱc96 K]ʬ2$?,) 7.j,qsU. POL6.㴺I 'oLWK85!Rbs>YO(zwEo Vgw8R;z>{~] ղO̙@s-6-¼Ŵ{hz㙜uX_[A<_ ?ݘ=7tn$ Q}3%eX1Dm5҃4fZG54,hsm~)r텱:n5 k4a^NZhh |d]H?Q03zdZC|AK OGpH -b4NL Њf3go);8>'Ǣb3v3$$[T|$A+P((i'|=\,N.׉!P( f`B[0 z ]{ 9|BQmW@CeЊcc|bG^Ji?/ڶ VoV^~^Zƽx3RK0Z@@+_y\o.LкѮUa0kne6.WM5>Q@SqvApiC?% @7y6AV[7GQpʀxVhB󢀕x{_&7@'tq_,Ʊ2^X4a8MsJVg_)7j'vHTZUž߷>c;~40xO;w0!'+,,Zj2,{u΂q9nƘ%%5tF ,a13jRf sͿ({L-̤“`@F<-Bf jKgA\k==:l,8K':]tGVJraOjC;B*: @9 hgkʨPL5"(EcU eGH߾]|ENiA晛.h>g5{,dnmD£+8Wre3dnlӖySqbt8DLȊ\Fu 6*V <9ȀHls{JM52bI&&%!Eor.gH,>!2*j7~a$۾ MX1e&z- >?nr{lnؖ׸?>bmSDu]5a`Ld_t~኷!Ak˟ͩ|ӯOݛRJPdYA=<’7|-2;ګ-,)/ h%g {̆9v -aS Vg8\킛46?޿Sεahzݪ_~HxA~x~AkaU>V(n"&ߣ*ܜ?3:\z%JMBf4=3In-q/qhW% $K$ Tt2Pw13oK>3 CfKWՖb7a"Zj>@gg1InHzWu#+ d_Љa' HTn #6цƜsʍUYr&:?{|ze"k@+y@ػ@{;xܻDȰH3AOm/pGiBAԏޕ/C4A@/ˌz}y Q/9})UQwӿ=8&hv2{Lw=(_鑅GOF&n7%`!RA[roR'Ifw4{ [Xa7L)I1'Wv%,Bȸ6(`dە8 K}'Є% npd;9ѫ<w^c/kKXl\=2*.@w%~7~-_5^co,:9kY:pf<(e78Hz(lxdݩ=CUKb3J4N#cjsS8yj/sZ?n Ro8 䆲N{~gǑ @dʏp[֑''}痞z6 Bn/cz:=q)W/%Ҫ[OKr-SIZ,GEυOFndjjp]Py׳16Lt~I1\ŝf&f-O{KNR1F;43^B$TDtԵ9tĺWZ|fr1W_/ƪfD]N3uv jDI]>KyTq=?aʒ&i( B) lc'N' )ch )WYvhQp<.<Wz4a<ҸTDCZf*We.bщ"ʆJ%ɦty!hFݾK&̗N˝Q)ǘS! ˦BV۶|<&2 L JUBi!kiE!D ʃ`8[)FN83C@|/%5A\GBC -Lx}4`}C;i!MFju#Ll@%d>nMO8h[L=o38l!j[%-Q/'d7…@ | J@E,w2iHJTیWKA})_AAabs!PQA`gffϤ6I,qbX:;^yC:|o_5(e%u"3(qorh44r4-Kz<.s'yD14_w5xGt0Hw%9v^yyڌ<WϡxFA6/B{E zdñBg Vm~  7oNӭLYvvK-}IUzA71mҡV]{v!vz\n.8z)dNDs/p^=5 vӾS hbÖ,OM>Y<@5ط6v,%ш4Pm ,ECYx13S@H#ϼ䇐0v9eHуEuPr^QPDDJQW\pLeHC+W]SQ,s:fGTs輡t #n`D!␜G!Q(Z䙔*dәRbtwwIVt0L q1; =(Ź!tߨgPxZ@e߉øPRzG70Tp;̃-ZL_LӲT#,!=$e. A7Bψo& ډ 1sDQ Y~KR`c?~ ?v>zcC̍TB}YcӤ O؛Cl`-ֆOH{8ڗ1sqEE_]iv+W +-ɶSm3Cu Rf﫩OE`o{-5g9%P-0mRm:OWXzgh eW-W)o(`܏}~c1B@yTYoa֓ՎI i}-F>=!cF5~Ҋh sa g]ݾ˄kS=P='Vfb1e~I?|)OS~?|Ư|""[%o?*h ϞǪC /W|m"V0duUŅ*%-Dv1?Pu92)wQU٣qǰ}l޶Oļt_HhEP ~d1`´ brvTŸy<= Z(#,4;vZz'!_cAn_y0ᱴ](T= B\=3-3lTe|:gDSL(B.iڐ`+ x‚Lva+ UG.7TЖ%wNg=;5\d崧-; fe[vd\xϧ9\٪A2Ȫy흃Qkn[qlǩp.F"Ĺ'ZD`qzZ0/V+z%3Ɵ4'Ɗ@!gqRYr<=>;V/йS Dq%l9QmpPpñGd{w (#R8c[A0f4sHo#c" Kr_gXq4/8Z:wYvfh.W2*K>;Cwc5JɳPy~N6t8yAwr\%b;1@4MCWJn[]8CiBX0e>ft+vru3.ywp:?9ގJo*8m_LWh)#7k[Q`䧁\tࠄ? ;k>㍈1IMTeB!Ng-smiHeX5R f> ؿeV+ \:^I0 c4Bk^4Lq6v0@O;\ŵe׳ lФ-hݧ3h@CjL++ [)(R3S7yn%2-ycH#1LO9LD_ @'1pܛx i|kCI1S՜FthLdKn7uDۂUoc:و[TԎ"ARDTf0eA `vSPItjQio (uEL| 5н^'}񻣮G'H>YU'`DMĈWWt?|SJ<ᐉiBCű39I*F{\uX[^LU6ߗE_e/8chZ3.{s$֥1ATM|j Gz cnVd[ WO~ 0; i}]m%)|)gJm,c蹄#W|9cJ?lާLfO] Yp`XM>I'An6.C(N_ Ԁ yũ5.x}'HĂIp\U}qhWsYu${Vͨ(|KGF-&Exq?XK(֨eD!PC.mw/*PR#-,7*!CqjD>.R`P*2haHu5h,[t$ƸzCT;Պ֣%(&3"O9{w=X(3rl~-OV7U< 7'jzp}J-/^e/ܲ)/T+wWsɏR=mܫ[E.z ЬhEH ]NYd`+&BvŸ{ F`۳lՇx@ <'VءVլ9:bdE϶ O0E)MH qH2FJ*nhUCĂ*H=xHBraRX0iӌJ 1FA2wAI%I}S;I2$x >tؗ_$c g `c V>6} 6~$G*wU$%v%Әxa323X실 +nɶf1t~chR|!G8aPT/0ha>kvxB( m?wBIcv6iSQ8M;Z#A .).Cd}́% ,E@k3{u.NJZl.BݎiEQ6us<|ٚ#iȞS7S4S1Мק[ F%c!ؠ`I\{>>EmF8^(7(^7ڃs\❹doT^W"IMoMZX! d6uig,Ľdٷ#3.H?Lዢ]Wu]{ nyvX?K-+vpbLݬFOÆ&i8gn"h$h`[U2oV"i5uފӵuUEM m@R#ɒ12ܼ!8`=<&dE٥̘ jdAZiQ} M1 7ԄJOR02J%2Ff?>1UA!weA@$90i:5Ki^!uZ)_Uǥki+HL_ǽ^zAM;}MuU5,cܻ+aqЬ4,kĜ3}񡈖XIzƚ}RWLbz' jgD1ÑY]ɧ*FȺh&wr{̚1n5i+G [_Uuګn!j|](T*,VosLk#A3{OK eC ѣ,)jWK(GT^yaaB q*~J90y6rv<;cEL(Z,˒+eU V_{Dr1^ )Ѷ;$oP[}cٲZY{|Sb4[v L ճ>0+x,-.I.vO?QMm\]vAҬ_U,*ιdVŐL\pJ`.G~aj~gôǚCi 4+u[J=fSÎO!œ|羆=j ÿ$>-]b ]K@UztD1lizj֨RƇ _k ~r  <޿+'*v1P1@h[-TB1iyoC|'sbF1UŁq Ll@KOfE $ځ&sŇ$z/>i3MHa ͥGV'Cp2/-҉6IK$A;L{:e8m":IK̳ܒUJRkj0v>NT ȁ!bNwg{D0L<8QYypXDڮYJH7Ո5ALG$cA$o릖4U/MNOSuǏS 3`d+HfZ ŖW'A]j̮Xw@Q[gZ`zR7XtD 2z7h^@6][Wu8v;hy ЇYkx uo| ݮZhbg2r?+*I yyB>;Åh%vsqMТ0kvAFI18],xjtn]/՟kzV;X 9rLu3I(i\j@s!l\+NX-= 95۸Gy]o vJ3])id}WAպ 6 WA LjB[?<C5@y<'<= "K[x%^_OxmR'4Aj㱲nX f ClUJqBc. Nf_0&5ھ~]}ytB YPfeQdZ%Bi즧nRN1vdͺ dRu0!e(B4 -75 -ٲ qోKiFPPKGYj@ڕK3O:j'AF_ԁ=4t &5뙠ub6Ӹ%D; E @.`JrlInާ Gy>z/,RfQ@ VNEQOĭ{u`5xꂎ-nRcèJ&qj̫S[ s h zi=V\Kl8+^SC=3uY6ŅXL]Q彍))=A9L6թM݊zF8VoѶ'aX$Xj?,5sC3. SuEWd)W#݌H& ؙo|%H!~M`[ ]oQsr @l=]:Y- j-ZEnVtCD_O+ZVر*1صIme1Tiw.zZ{IʽbGZRUGb>@Wvй%;vj˝.'ŒmDeb :=!׶.iscF !@L!MsmFKz+PQrKOc *+2VL|)bF&shJ5)';Zy3QSO>ʳz)>:I=1,:HKAįRρjUY!i<JQ̊nvGV=9jů́k3\0prL'sU޸THq{c*DiP uIoڧUY,RZZZ٨c֝6Pl%o6qrcBFLDk92jg[3Tf8؝es()0?zKa /Hp#3Q@r@y@Q (?RƀCo0`7d[^-k vqE*(dL?sݧθ]+4LJ ܢ-lf ѢK=v!J60p*YR+Ԫ(+D|!eͺE5CQ#4^_k8&;-_ $+VR=WFj-AʡOEOz쨸=#.!5M9g:_<gzg4ǵޛy 2Ԏ/E|AnL ;df^,$uPPu^q͑ĝ86deJ maQ"@xpdF0ƣeKcs~:/hIg+5@V YU:MlHMlMTNG+.9Q8EȤU[xH`WϥS[;*`}ؑOН򵣀L';M}G{Fl9NƑk}(+댕O\tp:fJSL$r4"^@s"h)Д޼(6nFhm*"j1.&ν ҃)wUIDjAE. Ǜ_ӲYA-%W Nhe~/L]ϨYjbL|YE<o-f~D?:¶.KhQ'\!a,S۔7 ᚋV꺠&uXnfYᗃg|^sT b2 uX9n@F>ZUgKZ.!* {,d}`0ZƧ:QYqE[юr3%CeT5+|\FnȂBfӎ0Ij0EAѧ1ח[4o@֋Z7L$';IlVЁs#١:d5)->G,ZtћB͗ǭ_ sǡy'7==vs8M :ƙ[HM4̿#aMM7 U72a^0տS+'V>-z{ j7z_ά~ fq$id}-UuZ1#ʠ$F,J*d"TKvtA4:7f|H􁸡f%ZH7WGJuBcDOsdVRB' S恋X[뒏5.d}kGD`Os<5;'$ɦ}eڴwwxN p_dQ%S37uil)%@ʅMJ``#3<66H.uⴜ63'L$@B+ ٖٔsXsϣ rj`u&,cX$v n裾v}pjb?8!>}:w* Oß3.ßC ?WL+??˓8Ojӟ5}.ox{&PeL)ΥlXKiP'<'" .1R,f<'t$XH{k|E:C|Dqmނu3})TuW(qqx|qj 82uKȚCZ<şr |\˸8B$e7);e2i,tL2&$:bB$S0T̡TL"vH b'`W zBŴ NelrOzzWuGS29c oҚkd ԭ$aZf#WÃ1/[ * "fcoV!1ǒd2tޑȽťRE|ݙ?r S$q5N.!˘߼aH-sP/ U5lCɺӱ_ͅuB6:'А6J˟M.gI;+kS2ɱ$^ D< ZdothfG%H 7Un?'HT%]lJ)iT/m   »Ny9 m㥭#~]q=r0Mp(U`tiنg{\$["qؼكQx%TDE*d>ZSvCjkfb]wlEnʞi3fh黅g3`so(g5m 璉3B U );^~_+g*#TZoBlV@.sۢ2Y?dNi 5 nn_I ͬF9Ȅn+&ϭ*F>Xrfl)+QԷ ӱq*ۑ!WSNj}_.I࠰Ha0V}J(t3fZ U42_ -01e>@D*W+_bv&Ӭ;Z|o`#$A#|UW<u3 cF0A&GM-7zOأqZU-Oea8f'VyHy(ܜlF9e n𒎕ڳRSwv!3O5N~Ed+~]f.Z1M1ו|︩xTGNqpa{`Y;^?u=g"|:Ѝ.L􎹧K+.^d S̓d!~2إR?U> Y緊5W_~6le_J3'Vb̦'@ÊyY@[!,RDrc9vu29/5@ %TOaտ5P(Ji\7TQOe B$/hipkȲYq"I_Q!OP򽢐L)L}EkF,16{2ZÙ^ڽ G~{)YC٘tc?g|=~zrab0ڢВSr&ilǷ̔ d0b+׮Ds>Va۳i}T x2[P1 `4h+F;T$[ͼ/j"d/>bz͢xG\mq*ȱ9a!V^HoA:-z޿}UW_^U{_&_7` Z M;NY6Wɏљ"jnhq_䯬txEfQjtM-'x&c–ly=l`_)[xw0p^-q9f沰=BYXl}:JJ-**qA/KZ hV_w3 1Pw呱L /ܲ{Y`5[)p4r>fxb3.a9H&nG (/\t}L/+KE ncIִ^6{}ѠB2{{@S {3 d"ٿA(K|fy5dҵ?ͅ\NQj%#t!9Rz+z -Dgʔ^Y>J)YT/Kޚmq$LQ &vw5%,yxiaW\nO<<|JE[!&<+'j= _% q{ Q;+BImF9*}ǸϪm)-ե5kN-@ȪϝKIjeE,AC0%*51hWkzPgP #ZώL7ufx#gۅk7ʲxA쥸x{ܳOgƬdq7j+cz6ߺY'FL7^Rn`Y}f'Z5cvjޥ&uO#qєWs㽹Jpr_%9r@Wdp_dDdR6`_ft3%3.l8SxTn~cw-{Y>NKe]E&*),m!*5_ X̆1r(@5~v^ ;?aҶuD& >풧> R YguB&iB`Yըi7@8p]}<,8ˤGM>\CώzƘ>O "+5F&p`Sh+ng.-YZ*b?½:Tj"OWiKt"ɦ<"+[yn?f@;BvL\i8ynȻm52:z]eGl"Y*L-~xڬt hu[0 pP@ގQPgP[vFݯ%P6fQŵۦW–󬪈&M˦QY>f@R3VO n20aĠ!rxe2}֥fjPjP{)^k/xd È dP*1kaa F)h,w[b˥BՐ32z@ D T:;Pѳg*3Ƭ]NtgDnR :OXvaH>h.e4s ӥd.E'.#(=Yy@@Jh,*fiݱnחV kbyg9 @Ly$5nZ r[A_ɹ{B!ݷƈqU޷ipV>|yˉN$Rr wgKf8VRl5C T%UWrt8qᢚdY,=%oCNQ;T(߬sY`cΪ>L~yD9FMܱǷ=|k=HQ grJADv7d..+: `P>,n)qOspI/\adcdK}b %Sf0#QP.)u B,-BMB@8 z5/[7T6>bQ gjz+f&^aԳ SX74zVZ8waYB?rL=hHgXSB,hwAs昵q͗ S_ WSͨ{A8gmP]* aJXmox,m'Q$s 𦚷NFɆaBih}IBXȒ.; `@\CIV;2\|so?Wn.L.ٕܪJEMٟq{/q#eX!=*9hd Iy@ʚ ^nגpS\o٦OCPSҒfuH }h}-UC7[uDQfc`1z?e5Yɒɑґ#}_u_r? ЫP= endstream endobj 11 0 obj << /Filter [/FlateDecode] /Length 23284 >> stream HWI$ +F\7Iևwՙc,6fSJz#bq8̏ʑk,)]A 0ꑎoo[?N6_QwϜs7]TGj6U=Ԑa{c_h /ő6ǚ|}O#~a)'3zۿ~JWRKg90v9]Ȝ͛\mv ,vÚ+7Q .^ %5uүǨP]"4[!,;m}>fgeۦW%d,٫㑾3u6H9aa1+N ?ډȂ(!OE p<FZ%Qs.H#לvrlʼn챆C- U΍zHuǖB.wga&k*̕*s讀w?vujwc$/Sه_(_bai1%4Jk.o-u;<ȥHkzR"7Xz|<՜M﷕UoloXFH [FIO3UT,ݮwjm=3NR őNRI&s-p˝xJ2#9sxo 9$YWN]Igz #:t/t津ݦփlu矺E5|j~\f~QT^ h .YCnOVAwʯ9&:6>%3",L]83GK "1K3Mm$tAάrbmCsAÃt~fS̚YYgf?¬5¯ ?̪̬ :9䜜]a3!ttwm9ꜜ6`qѳ'Θ{8{*srҸaL4HnS1 _SCN@65c79…f8NAaAaOBmOe1QXej5{bB6}k5} *ųn-.j5RkĻy@UDH*y?H'B`ar_jaW,^is!3X慢 AB2B+};Zc=dT=[ )Pvo&Һ_9壬V2YX8^qdmXZ|XMZRB a>.8l<8pt`C.V@3 *:H\1T s&5Y~LX0lZQ *I(ڱ>"LpJ~H ײ+dAy&ȁVL̚"{^ӥV:IFwY, [Uo-wiњO0 :TuaƘ;XvڐkJRQ:JkDOJ8.]'ϭI54Vp8|"ŋ S.8 aDUJUd!DC, Ѱx+vA͠yu&JF9L}D't+)$G 涟ӰлOY{U# O0RkYw.,U!32-Q3왫:Y I FYK"C=}fTm}{ؤ6o 4vgl$R.\ yf5$mw&:T%<1v4;s/UInT1D]YUd[iD8 1F~ũeL`w?"T\}sxU8?:Xm`,!)N(V; "=>rWUu/N=5~ \j4byF_u8nn~wGPs*jlx8>3|0Z;n_ir:NMZ(b};Х|ޢLnC!1'Vgh+im ^=d?RYEܿ6͐׽?WTM]6ծ6ud`jS7MM66?uѶަFOz/ 22Cf nȬCf!Ӿll!= !Cf}uv]v/u/⥒,GgQ%|p{,v>ZCFO8H6BfL3g=R1+5oH78Ix_6'D4璚p1CV{^J[ηo_ZJUL+U\QNf>>\3y؜'pwFPp;e (m>ƈeA QLyM̉iYz<\A=ŃL+LMcm :Uk=/+ /k#X,GWX |xskPp!w" qp/cHd7jtWqKWu]١jW ޲Rn%-?\@=2ҡER|S=%ׂcz DЖE)n3ͤ#$\\rF!8TP .5FƄc쥷mid:7:rZƌcZ TһXm~W}nDr W# ̈(bʺCaO^|H^I]6ҋ64;Z0YlW>ޮou~%޺XWi-:#6zKaƱa ~][8>t`Ė޼R1ڽOEfh}ȯ]…@F'D(n 5Ƶdž`}9N AKutI}CP¥^/g$e*b=VЕ(N$AU#% <15ɲpyv*W?rZI$Ux1>(Lm-G+AVT+Ł#9ȳbDW f Fɏb{Y YBKRI 'q[a=uhǨ% Pa-̞h &IU,%; 1&S`L^ r`< M^%y>&1M!qC3Y q-!#i(H!XH w(Ti=&u#Hh4ItCQ,3֞V:!cx!Ee LF' 4F-7:xms}I p9+֩jy]NJ }^Bnz7S4v~+V楇2GCUC;TTd!uLƖ = A^:KsVQ@Rl2r9UVX @tZ{m*},R9qha8khQt4c3 ,5>t^ KHbn 1ٙ-+{#SEFli P QGzk_ m60?x?-tb>|7~kMnWp8: [O0嗳ͷ]Na%1-EvBbZo_14򉟪#LIȾdjr1hSjJ7Bޠh-&" 9Em#|pz;9# Е^ng]%i kZWkq5(<^B; yꂹH$'" \'d0C4eQ[hSIT*x~2"kV}1`Z01m*u뀽46iSo8cH:P;Xa5l1B3tK*v-UǕBk)G(cEnӦ?ëM//tӯ1?&#X[4:3L"$Jb;"S8XKә@,Ni@;C9Bn nN~W:w7tWy%iC@I>rzz>EmC8^NR/\3J/_j NKF`\F`gY_~?he6ZMVՋs}2W*doZ]յ]Y)}hN%%藥Kބ fO?F' h'䬱6mSQE]EdQV5S|Z69 HLbtAn*5v*TA<j> '̓%sވ]ZR6ɏpLoSd_1[gA:_ ɫ<sfxC+w$>(6}g%;kfF_%IRAW-=f: ?(<<"+{f$ Ogee1|< EfL ѴQĀ"׳bf5mAxhEdӶf5zpik8#iתpv8Q\!f()E|jE#O|(٦k J];)so#6b+t"u`}1L,Fx-Y}Ԃ(&c"!M `Ji@z]uӀf H_Հv _րtj@Kh7w*0oT ~Uwٜ$qY4_;k 㜥h zQG":M΍B )b$Ce62tG)ͪ.i_ |9J% Wރ3O< I*iSr,r&^BP&Vh"ByW12.]x=.oϱ縕+3*I i@պ=omP1G5{U~ T"*+'AOEA߃KA($ IYàW,ztChKw.;qdxC Ү/A ¨B5[R,f 54l 64G5^8qW<,i6SD,}(K:KlE/tŖ"NkNIErhk7 EW1DZm?dB4fO [hܱ,ɡ)v` 3pN\! =աZT*)s|+D6Y7̊J!KUQ;[Ml5J =[}&DlV02a.!H*+("ey|}MAFJs{UhJq.a_+:ȜrI ^ŞZѩ?OzW!vM^*ɶJ; X=̅G)6=N% ްoD87`ԨLLJ1LD}T8j-)Y5sa+/8,9T3IaоNUM)z7P1$}PuB/=LD*0yps~͠4!mۚ(%sGͱo]YwM:RgʹH"5!Ģ.ӁfJ^ {(!qrA̕Jgϰb[ 1]u<5Yω>/߸Lj>}97'1XP->3x>cL8r`pP܆Ĺfգr008pQ88 T9w>tЁ\Ç>8dzq'ab1eS">ӔuO:+G])$9Xm3➮Ӗؿboyʂ:#!Yn{k'*(fѾؿboY"VzP&+mr? gE@"*āL1ɣ(rttԛ{R6Zd`؀rPuR5Wh>]..:D -mH|aA݃F2Q݁A 䦢\)*j=mhҕ\Lt:4vZ-Qe }PPL9k(xqR{-7>4Ӊi 08qEҦGTV0CkU*G?nnBs$)Z珲dOs)/󳤪FVjIr+ǁ{.  ]y3_4 QRS̢eޏ'3Pk@eV(Hxsa`կ3Dn`5SG@t:QkF(ypNt9CV@6sp"jhH  [$2qDHp͡>x¨WUBI>CJ/)EmtR"O i84?t sВr &˸h<;gSfoWn,g)^;Fi{]Z-Pb}~sT4#qΌ:9ZU/N+N~ us >hy~1;@2$fւ`6!Y'(1wb X2D3^N)4LPnͨ候2ˇ=)HwK j\fde #^D~AWI@(-7:yDq+-{QSX=gj363?3ۗ4/Wɾ(١nn>yW;ȅr m^++È.ny@_݈K6ۈFp\9di|,]˧j޽| 7Z73#w]%7fg{Z*} ܣU jaK&+o-7+{+Gj"11e+'$Rv1`{*6,ᘦEYdK)0Uk0[d<oq#FВp~x~wn-ڍ7iODi | 4A\hVHP75疔z‡1p at qpkĽ~gzm39XO1zXs^Ch6W [jb Ӌ8 & M΍0ĝVkpvm'ٯ7Nkk''up_{u8+}q۩`"KδN4{KS X͙ W\g!yn\g?64zVsU*ѭ2~E::L1*#VKtD%3ɃꂝK:ɰ$8ƞhg}xƟyМ(-Uyx#P>T)2[oHlҾLXtquiշCqzn+Mj=Oۅsf@ʮp-!Ʋ7IO'(EzcQDzuZBݬEvC̊7K=`Ѱf =7\(U7#̔ #K){258vĩvHbr=$^7.-Х$ rVd 3sV]<~:_ @ϡBVkԞ!B|^m~$:NmR[o '2g 5,ZIIS85MK6}'c^Ѻ(#xxXU+^]9#)9Br̼n\-K6Sb" Rj%hz%<0CJxĉ/ Veb54-mQտW ]^%0>HIZYBČc-6m̯ |Qnuo /r.™`u|n aݠe]=I[qB!}lQ>@Ivc`Mh; aJu44!O[>-Nn 669-Ԗ?Em.jPlgym/:wE/jo_P: rAv2P[ }J}Zq& yH |2HII37XRʆ Ȋ"ulNָ,l\I$Y٤N*ld"cTMqO+Z7ss:zhAY0N"^.@u4e惦KtLЍ۠$ch۞-薻I2Lrc(s dGțC֬4F.h'͓[4B D:|NaWOʌUtͩ|8vU L[!;\^ۀ&fW` YtN[1TT:Rk!"#MfhTBcOQ$Wϱ6#}I+6WQ@~k$?1os#AL 74ԡVNBI^e2rU(1y4FD9#M=`1d1; # ,ili,uXt%}6PS ik0XؖZihO΍a6Nsm5I.>-oΗ}ϼ>g.+KVkH +PZN2j'\u-!B= Uw0Ec*3"*D [|x 2EL_ &U>_WY.1Iy3Gc+ ֨ ̮"aBI6A]}FtXoXPtkn7 Ds͠g$ҏ'R?!jQGW6W&H[{Im]y]|?ܧ *E;;nD"`'xT}pb_Ey./P D.RvѵEN"F.'(I&NGXǸ/ܺ܄\S0Z +mM:(zR5Wҙu^Pt/e@r+7& .`OL 壤c-~ ,Ϸ.;[֥<ٺع.FoH5_?sf# S`w@-#l15 `nϞ2@AAf.39Dπ·VO\֑sv˹tA]N n NKiE jHmkRN>]77Xe{ M,#Lr 5fSA鸺>Lp ᥗ .N4B3{7 NYx XQ퓾}8vm-ڷ-_}[[qcCrtn]n[uuS^)A.lB@B?7/Uzh1-QGURA(Ymj4P ([C'YgQ9tj x_,QkɝڀAu [o>NU wAh5iH@IQO <תRDyȎ"tjb(Qҭp#ީj;ld13'U9Md4#*PVT_ҙ9!%ÆN(aRpt1rB?E,UKD^GJ94㇍z(Dt|ۼY#V VmN[žr" MD,^}."1LFӮp*WV<\ ǝK\DR R2UmW%Qy'e5_Täʩ6*ʘƬSRq'pkq/pSsp.z(&*D gri:|BZ1r{|ek`)t]OÏAv(m4Ce,>Nwϰx2oeۡ.D%-߼s1۹.)u=.='#tZc?hL}CS JEC+zx@+^C+ǒ\:K /ѴWk嵭"£I渀l֞WD@@3Cs VDD]"_UUۅa.u8^*Dan*Vx2OKڔMlgM9qcѭ%rLsCUk hdFojj'4v,r\nne $5W!+h 5:j{6$T iUSDGScQo5M.PZ+ΡTɱW QR0Πf6U0Δ5Xܖi芵: ;ݓ7FdM>}l,.1:2S-%2O& }xҊ1rRDuoshVտ(Cnc XgCId c0[rg# '  FzfH6*`E%79]aQU%TO|,Yؠ~Izj)ykiv]xuu_w$rWl#)Q%r`̄&7ȝϽ%{$T89j(kbp Iet! >;VIkdB2LM5 Bg%kAɾǥ'eLm&M;32ׇٗqEP޶k;s8¹Jyk| أJ}."Ȯ%9T\%mU2e9VߣpX$`Gax7*@"Hb@'ͩeŴ_g?&U^er\Y Rc%X&wUj:F ~`;0X.|۰M$Q'rb^OfL~X= {+ % pTZϠ xo{bc?=%_9iIƙcPZs V$Ĩ﶑W~F@±~xv[+>|;MWf9"9pّ)ǴrD"|+o i{-j"~~Qo&昼`x{141Zm<7\d^$b7Scpm,S-ETl5v^Go|wkH,6K6˰A$*mg_d~&ov3Yv.@n_۩gݑXrzQ^I4ņmW:2';h`vQէ0Y+Z5.-{!&*1'3SxUDQze9op)Yә$ՁZ;!M;hP5CAH$'ݶ>C qT^pn&s  Cg7VO„aH-gӱԔEaXzzAg(iY=Ƭ3XepX=G\_ >įjl㾉4q&.[V -&~eg/llq?*mor#O#1Fn#DҾL*ˊ;&*3r.S*HKJ[tEr5fC0~PXOuw$؂I9s-Ya6շP߮u DjcEP|mzաa]Wеݔ냮4%1{RYOʮ>+B%ℵ8MWQp&Xw ݐŖ(EvZ%lkܱ:\&"&l$k6!J,A4Eר8xRma:zWd@63s7R"wC&m ]D=w虐?mg .ĖK(/M]e -[Wysȼ!m ],olaHTahP&_8)]{LF 3IiZ}0^XT՛:M"yڻyX,DU6MZz2$"V}+ô*Жօ8rs'|՗1SLo'vq?&o؝m7B;T gE9g}WIܫ'Zʏeiė1PRM1J_T dviWPZþcql<{3|L-*V{ 70t}c6JG/}D:瘺x)〫8BM[KfGx'TBh { 6{ 8>b< z3M:(D`^k46N}^KIiCOPN.%soCe岊EL`#ߓLquP)).\ym|l^ Z3 dc6̥f .a,ɦ2* g _-96pS<U{/̈ YUʹ0fT*E>pGTa׉MQH%4#&- d ]7\DOgTgAeZR5u;bt+:.g\-`rIY+-3`wX]dNq v]Otʹ9< 77^9y-9ۓY!]E3xϜ>S x_ޒݔ ©mՏl:iQb+a H%!$Gc  jӲVtCsd '$uH,;ufҏw dE1L!K^jv\P(j8$O.Z=[u+JdY:Ž CW5Ɨq_xq7nYH= 3LŧJ/{6숵,}%j7vB՘JD*p9 Rm'ϡY֚Ʒ6|[:*\!I[D1U^o#J!VbNU$ Iqm1/ń* |i0aCysiLbraBQִ>Tawp ox[lZ9-tSP$ЙL Bu%H L̴wGmW>'ΪoX7K|/ͬ{㜼Շ-E.r4@NgVJ^ii.N@Ru8 fD#>!ƘYtrTpL-* {JZI@ihtyh[SIy h҈JM<.D.!^$2nO< |&:N"-;rsR0pt/W;g:h,y!9|qv+G+5cD|K ;$7ܤ\tn&IICL92j8vCz%R OkOdLJ>: 7OHCq!WDTqm?{M72s{;U9ySv ԡǘݥ`#|,mv:7fBtjG slxp.?UtY?$>~VRgUzT|} Bє7D:簕~*ҙvJtBfQPT<6ԷOI"$K% PlMst\sQq.8c3JVVm6,~:hNh֛@<ي=$pPʖ[n 쒋&gfnJ4.>ʁ?=D$ff{O);LWHK]&MN18p2$ڼIܾ<-:.[!srNRiT(*I>şLɑOZs\qT5y3X+MnoXO-I,(ӪBV}AXbTꇵ?D/tWJ*F%mA9]=h{xA|;rh5" 7ۆ@o|@֍;*;h;6|[&򄊿QuYԥ|Ebɱm:9+;v̏B9pqլ6w V_MX$'THRyG[ $0褡6φ+y#>=ibjN@"T]q[tAtkdyj1[ ;$_; yAصh\=)TOү (1? {>ao9^~/;ӆ?2o {^~I#KU*ZJug4wsy^pch׆9p;#JJA|rԳ|=>qaòn'&[djd{!?妫Q2!`n\>qk^`As-22n o| ۲\(3oc)L/Uկ%Y1xVlluϾD wTS$KQZ[ievجV`֢P$9p @5GL02R I39;rIH*Ԏ(~Fz=ۥlR>F0s?]J 7q/;FoO:a4k͠\8 a-wGJ:V|l5T ķ$(|Sbl^z6sc8Oج8^2McgX+ g1Ӳf7|>IhzC]gN0ƂȀyxGEE`ED`|X7E}\"P/G h/$`=H7`~.fyo/vHdY!cڪYD::xf|ez59!rCP<{yNTBxf(w_JeBw`j!EdWܺC̀TʗvSec993VvvRotG@jL:9={[P[(P=sKA4ÕMGTK=ԃ@y,y|Hڐb EWW배zn5]BHCv`0ER) $4{^r;0$FDy8Z ̄Lkx _/otÊY͊YG1G Ov3Pū刺Wnv~~FJ>3l" 8W@Gs֢3z}x7,3p:V!p\iu/9wT5ba +>>|E1l g>hbffG Ĭ:V]<0_](Ǥ?3jptݢr!B@|)=7fg\{-HgEdO˗t\1E]eQ +ac4@ YbvjF>,ц 2ւcs9r4̬MI)o2b^7 {]0-d@'tcS|ZF[JousƤ }{ĕv~4.>bU,3a{J'mY`{M*`v6˞}}Qa?I8B|3@[w (Kchwx5/ocR@:23惂 ~[ZfWpvlb_ĮGΪG,\m 6P)K[gƣ?oPu&Y'R\[ < e{n5̜y h:ܮwx03찒1i!c9?ڇ,hr,qXDi ܂)pK =7KCxa6;9Vɰ])chYtȶki9EOl1[ SO?_DjVD$ޚe9=?]S#c[z@qWg`s0, '}2Я@73xg-XEba^ {|f@vgQ(kKY=y6)A^ǬZK%?;݇~y*X'/nR+M%3)Ɩbf{ 3a M0>:D0[5^܌5|6Ūdε7L5iS3jE{ b<3Y(`۩yτ0VXsǼ87O^;C!p#';dwyVETXgPՑ7U"0'LLÛbKP#`OB\sDu[bl Z?쇵 ZҶ+ +Qq~|>TȮdߐe0ƶ<+!RըФ҉`v5K?j=D&J ' KY"93hSScjŁ8-P+{m٣-0cQ 0++}|٠k,~c8IK, VLqD(.4"QF:m+_q̃T>fnaCI2 Dc-UvT󪍧v s(e<=f!J(@4a1UW&a.(zB³OE*|g90sc8+#'_˷;]YnuW\%b,3qĪȰU3Kfrj`\v}u=[ .q^a7J9[ TWFe-jrND9^̃w*et6],h:ud%_T>) L{'KIV\mWc"^V+Vn9OMĺTWϠ,;D(Dxz4)6v7fѬw9Fߌf,4Fso4e4>NSrV3ke6,K_,lĹC4$1&=Y}: bӮ "]Ȏj*q^U;Ͳλ#q4sjjڀ7 f@ڃi3 ?@څspGY@CUl{ڼ[7Lc>~0,[ޭ֥+4ȷ >TPCftѭ-o*z6{y W endstream endobj 12 0 obj << /Filter [/FlateDecode] /Length 22554 >> stream HWK$ܿSY_8##UFz2Θ"v{-v{jvȽlh)Jۇtyא2qnKnl4j5uLm+g<拂K6r֜am3۰->r22$JFp`[t:@52(9x鹁8J u|-e:4GYhM+ز{BA.̥K 7Jda~E,U8(&\/|'MOMؿ ^qoE`\Wvo`fk }U6@: Lm1>yotodfӪJE\aգ\83RY]":>|ƃdƑCM ja.r H[,D8:PO*<&>yR'. ű-ú{xN?I^+tNX Mjڒ:A[mkgՋPtxr[(l@cy T8efCN.7Tsj`I=~Q['è~,llˉѶ)ӾUec$&2tqȌiɤMɋ#~ׁg}*!e֐v@V-oB\%"J+tHM4D?M4UlhƵRP䰴d]DEЄJ#5bːRQ?ȴ1/@yQVI ͞AAAUkjrNv ^jk4heԓy8 ;D"v稶6'kXe3GTfw&lD?6cOy@*_cUB'oڙi)*^CI'`ٕ״2. # 9J3Pl6Xcm[̡졉LC1ʠdSos)̂ }UmҡP?NYK_4rrǵA2N! f/+4&ѓuhm>:z(ߜ1q !t^8H&cO)aY~:Eΰ>Wkj?֩ӌu\1e'qlrj"@ڶ _R'%Hr&ZՔ 啰,&Wrƕ†g3tx)KoT7PBX[3i4-_fZ不_1? <0̬BZK[aQ^HvWfj ų9^hlrlaٖ kN6 *-*JHǂ]a 99<﫮(zU;#vnO:~NSg=cZj\rW.bl)Cz%q6oZҜjdTpn7]8BWR\M6 AKTܚ#&!kWl'I*q.k[^B|D ~Csvd@nu%Ez34ux N]gB8k* VXwnϨRiSӴ7M>l/5O4Mϴzq{瞙L~33eS˴in<̯J1{";»j#{vpyq4V;zz0&] R 4g =ZA ܦC ]!_i=_jCPLM^y%+ RaJT|]OihDMGP`]gYw,t}m%{~KE<"~mխ1&Auh9)ҹSoaL1bb[tbOWS,doj֧M4p Z*@[wS 9z$R,b] fF@[ʼnEۓZON= d;⻍FkX`,WҠ lмS|G04Ź4lN-Q*x6نZGr,؁6rТϳ t2IY|y\QHZݐbk(9rp>뗔Usw= ~6Xh7}gV:V/ʱY>(>eJM.^ "3#x!˚p9Q&c7b KӔ8oۗ ʩ*A4n] r-ti]u{|E'$0Y1@aONl)uרœҭ;%Uc}]M&Έ)MيC^rdio 8[( " @ɕr/JH8rF*"`& V|ZJ}D-<ߧLČ 봜9m`mӳʰT5l|bM^xA=\o)l Ro/ş-.>P7&w,̧aFm/V $ RBHAgZ#e1XC3 >Yc"өmH]XZ*u$g ǽ ~Oz58r,wm9ۊ*|x,V0 A$_пf؟fJ@Z @[@c|JǬoTĎg 2?,T;+0;zQjcl H'/8EB k8,$ zGvS~NWG;q{)Ğ͍$"3\j"=v6ĎB/A€;}y E*a3ԩ?fȰ+N%PAQ-j*ܑs2rjTRTJ@ p.#m@+|RdMsiIvgWn(u;S:ӁNI6:*~dBuޢK2sǬJ kRz2hzBb'9ڏ anܚ'rZy(3VXgyB Y#_}~NAlP__]r3SHM]Z=E:I ޝͩ\筎WW|뻀vv_^nMjYF'5w8CrpP>ePg{mʥYUy`NG #P|+]wQUY&]Tz*ڍW^ ~&\u!=xjiL7HI5tHNkN̾Aչ ﮴`mkSEfqӡp$o qӝ `CSe4\M(\_/R,_piɤeL.HͱIwvpD,0\tm\pC_4}|FgI8/`N QghW[f!{I&uJQߔ}9W|:4\cBbIHyfFPs Y$UǃsC b]eِ=+Q;J}0az"*OcM»Zk\k"R   fXj!S9)qWvM(FpSht,,Ps[ާhylt)XpAtw6)d0Jv}vM)xeqTFښu`GޥX򊊢~cAiʼm*em3=nUsn7\4%6; '܃>4=AλýYW?pttA\ ]o2Qz.tjh%G(7)M ki MRE'5"h&#UPA_(vn$:QBh?aND ] g WPf/]3oeyH:%* e=D%/)O!-kn&8EuSk43Nty ϡP]}$嘪< [|yUL%HX7 3 C{{0ؕKb7HƺEX{Dq9}?8e鿟+X_ʟnwvWvWUv1E4'w2=d[T%IH+ܤvsadd{Vu^PbmMehv:7)#_M*|$ X%nEnRǔ'F嘃VаpAF2,becR-t:x+pl(O!8Q5j5rKDKX\ &%% }{~șn!a\o,9灔 zpy.iFu3aGkalKӪ]Wt<*2s["+ƪK #>۹ ˪iiA|Kgf-sv'h/\?_ϩ^yeA9)*ddPilc.D}7EW C b]mohjogZ-ak˯ȯډϮiٓnjXk~| Ipd=PfW Q1kBelK=5LE .|J#RG4OΚzh<1$|& N%_UJ.AR/ْYIp)G(łЫE߹EZf7j*D+%ˌ!S dK~@je=.V4 lfV~ 2|fl ZOe wx6r ˾b!1GG'%[tc#2GgxdHmXA^E*(l$8ٍk0fA'g֪bg*xq/K^O%i]3[UI)]N,w&jvS1[Mh& Y^m=3[-K%I/W_k5&uDWdv 9{Yt1w܏Xo7r;O-GK^ '-]/e \>(=بܿteo-0fV*O)־K#ϧB_U)yhzxawtmScW9a ShBTGtxSnVG71gEi&d $њGfARi2Dp+dZɱ~N HA{̢LeJr䲧ZݎpL&>TqbQo}t(nR+*n fM!jM? ) FxΠ758Wf08#!rGSP ͥ~穉+E`l;wi]{gÊ+6(miD-zH#4`=R{4^CCz0 2 \v7"اb@aP*3$Ojr=gV%ڡθ_[ CˡvvN:{vR-vT2HI0i8׬PDbQv_H͟*%L&" .z\+QlMVN Hz\ fN1+,5N*OES\iۤj,t:*Ɨd- :Ծ\S^ͣ_B"Y=S?h*7壦|%}1>((T#|F'DFrF%zx|'Qg#Ñ2W5 hӐuYtS,j+}bbq;&2P>7-#5[N:LI3)4]Y&`!|N@!ge䨕MDgZa|72Ee }7AȚ\1zDbk.ͥjr}Uv ]@Iܿ'?8rr/?@eOi9+|D蝖4zq\}_79sh-~S?js .Ir Q#r|Ђ-89tyYܶƒV-P21-5kk γɪ&2 h8>Mn1)^ֹ[UfqJkry7OYqY1LUrCF> p#Z2^E4*]W8,?'fMaA>{QHگe~DHZGm0΅uTLxk37=֞..ti}:(<-#bIGb]c^|7f/K?:O&EH WrB "Q}tKtTC]S1g(&^cI$!9R@Ǖϓ^MF1&$U0Դ| e MFTb Xs .jj@'i*gF#'_Ԇanq¿mUz~x"{TvU \Z# ʧ#vI^kP ?6 x'wQt5#Q>QLCLDS^cvwB'}\<_|| eZ3i.<&r"&Am]mu IGsLfx f\b`o _wk\1A|rEmY$Ymԛ ^Lo33 CǕ::փ:֋:l =\>jZ0`U Rl6d:)KhgqfRJ7 9u vjB]B>(N:݈cqT"bM̍sZqJk cYqYl,b9N:d;.%0%z{Kv(|SY>UDʘQy%|Nmmb+Iz6x) .{TOj;G@4 ǸvUGMȂC`US{6}׿ZFׇQkߏ־}o 29m`V\E!jk גo nFiݻ'l> ,2)XsH☚8@@Et88ד{GNb_@EbEʞiRyUH>8ĭ$Pt;~t'>4;,*Cd^NS`XHa G K22K [gw9+? |udi .x98y8]u"LVCB6\\Ρ)%S2$m"MAWqɥ 'w+-R'3e5,Թ?7d^j3:I8vvQVɕM" r}紕npS|c^ ":7˨dTKJ|jհkW bikb L}v=?v'??VC ]<)9ybkU"Rڛ?a01 OOǭN̷cJ3nQQ@ 뵗#zb7iu k~8_9w;?tڟ`uLzt&F);4M؞&'(ڞ(lO9DQ>D}O"ܠgjXjXF4X t1KLYC+ל-# 7nG7ǣva&=+6MNT%wz&X5ԩP>6ʷ`}`U*! 5GJ+swJkHnՒdm:\@c|y#0B+y; @! 9V0bꓙ>$fm]Ք& Gfanc`F/>Kד}4΍߁uzKPoa><~?ԗN/C}?L %\9hhÄt8iJ;4h''=MB_%4M[Գ]f b_t+ I1ḏvZ-9"_ W`Y1m@k뱏uoEc[#9~ C+IځINE(XG;2r$$##V~h'QHڒPגA012&L4upĤlEݵݻ6{ e0\̎N.յ?]5EEZɿk617u@̅4 fsADev-{[:m\:-.'=WDBYkeS%Yat)=Džf= ʾ@8ǥSd#% K,V݌  `~z'GP\7\޳KwA 2!O?BC#vΏ֌b8-Ԫ>GnL=W:w&lV&slyD^C#,7ԝEwdb7vtSCٻ@RGwَWCk<^i]W/ўEU_BYT( FD}B٨P~ǩPw*;7R~*l;7SaF`w@Pu>RHߚpO.L.gk dCqܵgȎ?\Chg˛-9e oG;aݜ~O,''?. csutRַC8b[̥\:fx'xqmf5ڀ@8Z ٗny{X0ïVrQFt9]ǘjwũzt{y!k{LQJSEKV/. QNuG*G_z?̙O~B 4~cIqx 8)]wܭΆsi$~ůoiednIWk7 0)0)aRa2Hius\ʖ=jRfRLj=TLjLj:!LjB0@ `Y~;4 ZgZe=xS"p۱&vXbOFT8c`FBe4,m,*ʪXB>KPZeXff%&[ 4Ur ߺx>sD@U)QWNg.y-zXT, ?+>nx_tm}&5/WwMt)~+'ᓓ!|ZI9P/JH_(^¾:U؋2LA[)}"YL%ZX+KEl3F$:PK I׮$("Ua)w!bqX{!e߽x2^CC$GH P> i{ wNs\$5J5Jc*-'!t($*V0MاJNtΠ6=>8157 cu0L1Z@.)s!/'yPvJjwڢD;o~-BA ?YYk-}yk\'s]O>`!tP)Kה/v &/c͏rtZJ6Rl'@= EɔQP9_;]}雕S:?L.FYW;0ckLy:ڑ# 3)eϠcʜ}Jldx ~$٭?.5Q+p,RoPx$U9D';*P[gihشxQ׭1fyvojQ^ ˗Ӛֲpj~x|wbO/pw4xOU&ڴHk˷yuMв1¯R|6,RSmUmahS&) X4)qoi{VԅNr?\6`GҦ"y2C?fFIG+*p $'mg̱ͦ^0S@1i@t0Hi}(/ l'tyK}f<9$VH4.Sp:sq?x^qO TY}=]ZB؜4tl?{r)RW-}>6e`bfSdVHH3=aAf9,+"f}dU*-=>'U4]Uդs *{`yIq:GDSJeBY56AcW_kiݡx7-{m~L۠Et^NcTUy("Lm3W#J˟F= TCqu:@H ZHbmxX4\b%'Ht=zszi)5i~mOVRZp -^_{q13c<"&( f?#B!-m3ʉ.\-Nƴf(L1 匳MRD:V٢-~Yi[;?Hb;_=Bߢ%AaZ4}v?d0r2-qy!%)YTǕn@U{["p<:KSHw`Q[VCW +ֿdn7K8֝{:29-moHݘuڻ H!1USγrrO^ǿ[G{[ߜy?'v^cx칧d~]ɬ[ZJu1\јY"q=.NKKo |ݝp{0:ުpҒnueq{\OFS{Ɔۮ _rk̬ZNѱfj;6tncru(YyL,ƒbGms*r9-l vE6$o dkQc}WY:-뿩8+4,X}r+nS MR OLj<4>] Inq+CO P,UiA弄=+<-/NleanuWfDS:˿!5]V(z!iQN+7E.(_;WʽPDvۗ0RPW杹zњ20sр+ja6jxj6Dm| hT6vN;z@34lnlyO5_O\|Q!;<^YY֑< Pf]+2wIT7Rڍ4>!&n=Klgj"x%q3KYb@gu>b:rN* Ύ,φDyiXߨ%z&U!DfTT45[F;1 3TusCzs̐XO7GDK<:_ODn7=FX8dڏ`O2h9<+'1CU-,.z/lov[#(| 7\=zsiG?3krJUl5ruZ`҇vU& 0(3ûe{?eL`2ml9ۅzò0Ɉ)”P!iYd$Fu^,RYꪩIvspΊE8ӢQ EYD.id 4'3՜y/uLC)@Ӿ'BHPYYYǶ]"tM/-c\ĿafLgv*@{U'+oT'U5wK i_n"f[,$ވ (}M[wʤ{XyDUfMaq崻Lޣ,ghw-22njl)OhF1+fXϗZ=k|11ۇg'٥"\FV>b*&Q Ǭ"^ iYoRHl<w-;<0YVW}07?e% W3VG֣XF[:v׼28f iBĻJ=i醡pPirp>k~3yMv1297{D[CwP[|s@m(]Zp▟_n=HQSɃNjX]f̃ޯ6IJ`V:KءWRFC?/I%*-.@Zd jN#&:=USHVe8t9 po\N0`Y BU+.np .c6gY!ŪTk![ZWwXց`}t#:>ўؚ*#9 [9,jm&qǼDs9'UIre/iNpbM%R 03cpVGpn#@r_۴.<=o߰,D1TcI" $R.|Y*PR0hVv#73 vq;$S.e=ҏ9[6=d2OCDjv:RpCh_mdLZ Oޠh$)[.̅/,(5֨RkTk%euG =9@'W6m'5HTm:$!9<(FPۗݢ2OnmI^>I!ɵS`z*eܪTn QLȿ<*p5\V4^.XL{* s.2鴩mLk, e3>ޝ ͊kݗpri+QiRqA=h'}3K*V-:wB1hvt$=kr[D ~ʧجlV?fu6+f=6[~&SdK_& 3UVmG}z( ˈپ3K!pN5g>M׭(jB-pl3?B߁誆fӚ.Vn{љ7w9Ozb4-{0RRuRռ?ȋ CbK7GώY-UƐ3[|L C7M֊+ӫL=J-l0R|RQ<9p䀺1l'>|}yC |{?NneSp>E++#$$' [@_p2u0S5;]FsW5r2Q5r2W#JA\ƫ%5r#N6fƃ۪5AkgZג\30+Y-؇eqAoa*G(/gc~Ƶ7߂Zyܥ:PK*FP5rGV7Í2"í8ٌLOő]6Tڀo.z,_14\wb _$n)"1#5%5|R"| ._3,v[Q/zߕڴ2I=- u`mdkh/ 54ܪi =qnuJ"0.Ȧ "q64Gc\Aɽ3 ;>[v>#CɡBS I#Up>̷3k \Yu6$8MjMV?y27;BLVA:ВM>E؈p2IʝܳD-KSwяral֟'D1ՆHUD0)G$^>JwQ.uw!N9hF=-`4SɲƤvv; "y!߮6H}Z' .=;qYXA'Q?/Q.+kۛ|R k[\\m2'${S%R4OtLj7009Gs{׷ɜQf~hF5R/EMy,>wISÍeЊ(g)|f;"pK9Q1WVB Mj,c3ܼ8qNg "\}ߙ,EmNg%q pLJ E`N/,/EeM})5{`7ag ϋ;MLxB׋8grCY{@.]ƹOu*Yx-HQF0:(p ٌdj(][8ÆJ;#XD)&iz]ԐdaYaY)j%نloR){G1o8)3@dفw`1uaHMXiW1P̖H&WmE+JtBX ` ^ Lإq=XhLGxeOoeBee[4pTft\hvŒ@xߑ&ڑ W;x뢶1c8E`š:P'_3#e hgndѭMX%y!ۢqU-uûXza}fujj9:'+˚7{v^sI/a'T ˿Y٦*C.qRR U3fY!|.iNN㈥(ƼX{l vALI_=9Z);-^tl)z%'9LB'L-]?@+9I8X'х3's}zfP"$ l(t . <5Hg]DVc.0A”>zEd5@^׬J<澐h|&p*L >)K޶Pҕԧ͌2봫`aq\H K z\ @ܥ0 ޡELD4Wwa (?@Iksy9JȨts5jʓi7WSo>zs5jҼۚU[?5bkh@~5k_5 ̫W_3k)OƦߌ<ٚ]Mm]]Mw5j]MDzmAD!Tt]h2Bb)=Ja5[\1tVpEH Z X.h흯Si|QgE6$wO-pa3&qM @ACo7 V,VrTa]A _>B{pjjj~],= $p5;*?eH%{`̑2^b%;ٰwqc+S1f!Bw٦ƈpc%]Xi9ZRaPmϦ0P.VI Cjvbn\&_}+LJȷ0;sD',7f)h?p,hn-(}*+eVV>ݳ`+*kyڮluTV1*JQfdr]*ⷄ,+X*tzyڮlP/eպ^vhw;uQW8ZZiG dB+3}`2ƓD'-iS%&Jзn-ָIkF7ig3sTN͎X[!DuIzW=)&{NٴO)u%j:tK !4)N)qz-S:Ҷ _n>R{HW:_ddS$)jw2IY&1uM1]/l1TB "]]~g/IVWf;֑ w:I> ^5T199f^3GQT{ 5м,q3}.O?w3}L?]RwY9GH^H^!:0E4Ԙב,S"P<1Bʼn(Dng;BHz}sceeIH/̒=;J@<>  5W@\f!OjV(_^ _Y]aVBZ͎_1p߆vb85/Y| ~>'O@<Kx+JVZNw}&-F8{+6ue|> stream HWI+Iľ6 +LG GA<2u77@17ŸpL(uG H$ +c_x_uVg?Fnė48G}7f8ocƩ_~NK'3n8Yn{2 G• :V|y_y_~oS7~y6. x/_f/k~ka`8.o\rԋg^p3^0|7 '^DhT-88"> ^oDG-h[O!Ȁ-}ҹsG)5=0%#G"vA]!x_:ƈ L'J9f +JԐLQD{b:pK}1 c\Fm NDu0.x ;z#{eL0m-oaf }c hXg`1'y2 jHcl$݁O1!83W'*`2>_1>}lYΧ+%Y7އa,5Oz_G HαϹ=)loG[gh[;F֒Ẁ\oDF2ιo4IyD]!SPXXY۬5-‰_r*- AyrsB@C+"J[(DI!_@\cķmCz+)H'qZԥr}rEԌE[Oa NGbjLښ@@sfߍr*CW+U@BHʋ&Rސ`*&]|jf}lCGjBqOCqRn/J'P;ZUY 497rkiOD[`'==ƢJ^pnOh-A}zW%fZuJP>$l(eW;>b޻.GU.e/:(s(8P]Wi.Q[HM.8F&l:9aic8t}tZ.e eF{+B?q񚢌n[ =Fw8cuWV"a58r7 DM؂fgo0)-OHK֌E1ۀ|RlO@_5|I5TS\a/b`qoc5,s{LˆxinQЋ۲," 4dVIWtJPTF8\OmEmoJȼ;V-PG/!B yL|N4io1Y}W.cZo0WGé@?S4eO_e %PykdܸcjIIj@;'/kv4XOzLVɰ֨;̉\%}]_ɷ^[p2j;(R*YϻEZ4os>b)5SVDL wwe_N˼.ulozXtRדo;˅-dʌG#Qd -pMj6:nWT=L ]|>C~ьKгajPDžlxebSYv7z'mjJ/>ԤinG@o["Ӻl;ZD`AZf9-Q.Dlq[G@r,i0H>q3:ʈZޚ0C )n$Fp<{ x 5U@_"6g6d3Bd7>~lAd+f+..;\gſ%/J꨸.#ƱtOsſ@?B.F&"leMKohaaA{ f^7,5Lw!P9SUBx3W‘[ WDM\M'Ҵ&FdT2 G& hR6QϥܲPC{:ohI6F2< a iTP:5OZ՜_eE!vͣ >Д`]%6?0t @8U D~П}~"8$kĩ^q[%N[D̥M{JWdgNihj }m5u;ǯj$q@ͻ_ b61:W=jtίMtCsvaC^rǪMʣIuY?%(6:N #+ azG"EzBPSffĝ8?Wj(DE{]̶"nhF(9(e/v1/bϋ@(JIB5؍2l 1 54+i䬄@HcE!tdİ(Խ(ATTWJؓ,3[;4ѺXȘ ozʌ XTD0|1%\$9 Aְ,%d7Z 5IebȤ}_c;U)Ľk7T^b~m@%: n½3`3/閫9.ٱٜOwJ{Cs@q2?xoY,zD_T!Y"R/5?8:ޏx c:²9IZkʂvNT9pi+Oܑګra6Z$Ig}t8UA9תՈy<}?J#踙ULIQGOSR"htm@t^YnlqT-Fhʤ>w\@RAbayE:ODٔyfcx] Y{t O$y3UDUc5']LiS2GUx*.̡Mx0(!kJGP۾i6)#3 [@llrygkؿus+Ŕm).nH3)©d[bSbaȒnG?9kRfp_א9ouS]r}'wI\}WK:' p`X?~W+_wotxғ4hy.8t $ŧZv!3)-DCj ~Oin;f&`o]ϙ~11>ۘdٮ7gȘ&Lm vv(ץ.U0&C7`l$d\Myq%dwf_bJj.u빋D.(oNe\]b]21J<4&O]"1Ab#R0H̡HLvaFv4~b}Y۷2$Ix$pQ޻E6(Sli4ԭ0@_j,/]-B:.yU3c+fuKct0G%9HMPoׇmW3w/HSGq"Q?~tS;۳޲=g M—EUMP/u/{/Rd}1Z9I =QmF_g<MQDΒ]5VX!:(#)s*4Wטgő˵a4P&G]/e5gE{Z\ϣCCe8(X0w.iJT/,Ҵ[g+{gC*$S[i1t:SMd/њΏęl_"R:J8w'L-"DID>A|,mߴƬOJu>=W׏y~-<\0׃tu^*bb MwenX+Qf/Ա,8,fnȚ-Ͻڲ@YPt߶ߍZRa[:PXPr+2E%qXTo2oq[ap3zfe9r o>RY aV4Y^wAMߍ?TJ[luH};;:wx(|v>NOP^ ӹ}t:8t.-^ՊOU?W{ۋ){>6 FiydT)G̎3hYބغ܋{=tUW| "mi ;=ϼ$}3ˣ^HƏLnP ̣gj! R/eӦ{>&ظZg=!҅r~D3Oݮ‰ k.pƈu>6AP Of]߿=~vP?^!?'vq/6: ƛI9s '_ s?q;s*:`cvg;ВilaCû̻d7F%`5vmD:-Bcrs<:G?\vcO@1 gSL08R/PwiXnV+յutΌ _ܺ9ՖG).#yc ~f{%b 6d^i9I€%P c60йfPk{,o߮xc;Fҿ>BzSP>=+]& J{Py=A]t1e4;]uٵiP4 lnr,KCxQ'],>t1Ih.6 0\2ekCu\%m֣MF!Lߘu͏27\GY/B8Uj.]H໎sV89ž 2pLr$C!rK^&-P̪f9IIYYV_88)Ib[)| H =ɏ}ҥnqŷp0KfjSkO;oG{q=moxgǼkG)H%)[lפl@lRv=>dCmi5C|> :]xu+$E/K7I$O5*UvKJ{1*F.X7G-=Xpڿr<ؗ5h>"%kLC٫Maf6 ttaRM& yזQ¸~/4ckV'_x$fB Q BtxftY-ۗ9R:=Vo'jE~wmc"Y-D ffj=${EB8aͬgRw_2Y-PEE^v&v,H7:YTBWef~}qĨM?fFݞGVCtI֢]aqeXf!] Íq1,NaHdC1;"-3OIP-2oJ 'S9s"A@Y.]3J9xוén> ]93a,mkl: *m@N5I*DvϠU&4Bs4 (എ-// \FDd$1(j>*"hܱfȦ(~/& <'?g)cP`:?[D2c"/e`B&4{;xڗMbOuQ>\'c.zO%uJkor+žNfEmc^`PֈmHPx d Ѭ+N:x4k)m/'ݦ9MԒZ*HfG}O HlK 3d=Z%Por^UC\] G=ou؂3jMj_ᖦ4b U>] $ `es)wXY;M4)0<4*jdY P,KQ TtUD۳ֱ JVh\К. /5[ 6oյ* CxѢmҦ+<%S򒌐\[陾!åu͏ 9 oΏ F_Su.w 1OrO򭜜eA(z9t3*P>gfJ~ϲ? 1yBp6'o89: z 0y%ۄ<)2Ʃb#_%ǎ^/P ?ᅴ/ɪOڴz,2 FF.9yco V~ O 6/'wqR=BZ,v1 WlXAݟpzUz;v36h7[A/PR7LEaaS5^ 46K=mǸ2a@OрX|Myd< {οo-v~e˶ɯMZR~>n]`dJ1ߐ[* ? wlO:Vl0"<̫:2G~fDDN5զ/UM+i d~dv>6U avs4Cau빋ukM3Y8!Մ qfc-!ӎMq#z]znt=#k3|SMX>I$7uuĈ4Fj4rsݛS!q)S\&mvR'YmE1ڂh$7 N(r/ޜ my}EԭWWrmM'h%-C/H\gtdwO[y֞Ct#ʼmpӇyWӁ""´҃ DU+Po ϼGW8q˞ˤ%|X̃yiҙE'(=.#JY4\XQ2|UUT~AG\=/Qܺ9 *GF"32, C9Fقl ǀs |4 sFopd3TJ=>KZց4#JQO,ZIWrdqzo⿪tBO]3M3@ڣF6=xAIURت@ďu6Kg;cӊ? .!%BQd2=-ɤd iJL*~У;drYOL`o8H#˥3L8?ϰGKm?~oLZ~7h&]Rry2)*@ɘTLH:uI9 I11i7аpif7IGqXP:DSA*fi<:.Nm~Zn njud[Dʯ pV4*(;*p=P@eU$WK2Sk5^.쥴׀f#c9|~iLZ'(,7BɺAD^ՌBw`pf\2F^B%1덐3W$z{pK=Tps7O;N~K-`ݞ/Jk+|gyl{0%kc5KWRs (Y:\ux3bN؝ԣa( *Sf|Og(k*ͨ0 W=Cޛm94)VA!^8yN^::TϯF/aӣ' Osspt/=yl% |%PpvvneJ śYrWz 9:i}deB9ūT c+iH7ivxTHV!wn^ñ}u !˵wil͡:MT; ]u-7ܓ%-b1 FDU%1^bT=:bCSW9Kjda-=X1?%#wX繫,z&*Q4Tqu&kEڴ[(mķ >8A%˷Ê!QXa i.A#M)V|S\b*E4^D'[50@z sL?5m"j»E} eBUo}5|F#qy#&Q-@sƨF%o|l{}f*2|w)ʟ&}6gJQh5 %7{32gam2aډ*rrNyܬUu=cwߥc@7YЁѠ]%JbjzC!ĀZW T1P^TA5A;D*71#s<`8-(W[.W<\0+'1ž6BlWΏMzu빋mwB.-ivzο^W!_44SOf\ڝT<Ju/j@K{q:'=<o\ Si+ȪlE0 cFqdK8F\RP<*!ZVUg?sL/(C`Pf~=GQ-sZ,ۇTsμؼYhܱWU6?p$Ҳ |CRͼv]garA@6! 抵lhцuLgOCx9Hij3TJNagQ5y!IAK <3!TY4vM[Iso5Sf ѳɇ^"7,7F'\IOԤXle3xG7 .@ժPjlFxMhNjB|Aԟ>ʧz$\~s#=J pB&q\+y/<`>𦑕0qjl4ROç!H~>6@0QKҹWjvfKyufwMn#YBMޡwaKAQV+l<\5@܆d7;՛-2>ȪW5ks,nt:}tBwo[7z QEn>^'~eTM*J^/_-9$7lSy޵7")EfU50o{̌B&h^_LZtÄWRI O#[!l \cQ 9"ϗ31k?ڛoA1'\#t0J;K=:c(HDw)]kZHDA$vG(WoyHY(VK68J@#;6-  .V@x CV"HR~-q]’P~BHY"+S& Ѝ4XWlԸísfʂV!9џ%*8}G׿D,;Mq+,]t]5RE)̣K?b" 6a&.٧;=HU})n%+N&F=> ,?jV۳KvnO٪W?C*i^*)#* cL]U) P.V;%sq <Ή*em(iȲ|Zǘ>2ې|+Qjb 2UVUwX %&KE s  C|ep;\=vi]+=JIQ;;>zD>H|ORhE1s&&@8cGe- dDͪc)˒ fUxyxrGVpFtKm{ { u{ ) ෫̶>yqMl& h۲ ' k2T3+o! /gK٩L¬ YoWdbSH& rZ-KQd،)gzPŇz[Q 'AN;YӁꐁqhn|^޾/w+B}tUFx(Z> ,# qV"g}0!GߊCjun#I6p8k] 1r9ģ=ElF\@##^^4T1&%2?N\fAVf酜|IMRۊ{J.7?mNM=pomĒug.v{ĩ]vgyFmޡqC"O:%7D7 pv[$VJysf ml];訔!dP'YCIݓ*K+ H&gzDm=|OT[ !iwEX$ss&6@ @ƺcGZ Č6+Cʖ}ʖa:NbCQwT96Gۗ*uu{ 5/`d݄L}sm WwS4.0--G )A̧(L+sA|億H;0eB)u-"v'RD ^D5VEs"} {~*2eԁbJȑ}^QH Ɉ̬t[Y_T"A1В%ϛGkrw#1x/\0<pRͅ=Zw5+=8>BZ|ڹ B;T6w˱d9Z,DSf|AX\NJo%-犋*)$ci I3LL=\% 3g"=ud}_V# &+I•npl~g h`@Oɳ'h^?ן1ߦl/:7iu./G׵]WT ޕ|T/U*'?>{AB5sq"&-qsܹ^@A]ӳe W(m>/bY:E'ɼϧDK/einikWߵx=_W &Ƭ5 eīz^+ /T|W/5> G-ww-F6*EXrj[n+GT _^ֿEx-2P q0/cH ѝpܣl-X(-*{BUd&4c5Қ|0r|:٨jQ[m*bϒIPY~g!҅17F 97[\ƬS %;N_Q*],C >X)7{$& )q^4 i$pHkWǢ%˕Q7I"?DQKbx{R$6@Z?CF͞c^*t^cU?z__ W>7dk3d%G gk4@yyqanUs)k,#Q=; bR)4YȢ1k^t8&oT+3sth fJ3{OrWI {|'87Y Ɖ S'[rAQ=4սi ڼJFHq@mgbtڅjoԭ!Shasv0Czڻ 4l1!ȑڲ}|%'z_%J;3=j IMOk>E D-}7io92u}]YXmyp4*d4NTCŕmIb+u^&+cd᷋d?Q}Wj(vB/u_F (G =)iDȭc6(/y估)h!} *!m8[RX;HhzTLld>Pf6ńPuhm SU^Ȑc(4pZ0 X(ws;~4{%~K5JZ(>DV-wG,Z2pL֥Nj0fM+J:r>CM<ΰ:I~hr6Sx,`qn1GQ{#3?\)xw4&VzYg|{A=k.اI%Ipz,ġ3\]V)\xzT4h@ɅUYL1Tjfېnt=_Ѷ1]ۼԐY~m)-Eh4]Rk\@V!@b)0/?IWTM7.1*bS>!M IȻF˟X_{0O&G]/P}Ug\;d3 i+˖%iSC8G_G-˅];d]|J|[A{MW tP$;[<(f'/ѻ#WxSNnvM@>+P-M=R#Izn| d]!bo! a3T8rOW)}mtE(e.]2l6G9p[0C9Kϫ/d #g* ?S~_o%P~{hZ HixLb!&:kʒ,dmu I:'90G{x6'CŮ6wٜ_|<&՞}\fGԎegNԘvJ,_,rL{?8͕H hP*c2UD^hLJmUp597MLJ:!_PI/D1ywDv8[N::Z & H mفDcoӟܔG<I6Ao7›aEƎUpVR˦ Ǥ/v]!ݒjAP: jѡhsǔB+E.M۪YHM_ߎ.9IfTe+jҰ/_]ceG?׆]=4Z;ы3V\.ў3!b,O* 7[(̩9Oܻμ1Ӛo%RYL’o]dqYyRTBV*IS!fv491c(K;J46MCמMֹFU98-MTk d0OxWyĂm7YS$ёDS D!`)==F=s;W7bT68qJ%.xvZU2Y8ޒU: '$/&Jmgɟ%%/Xᦨ{ PEбr\J,!Q. [jZH5Bk("X2՞,?k¬[mbbFRL^*G@iPW.]n"ƙ)p M, Ubz"s;fV㦺ԂVDbu`{KQb)VǭUh`jfGsz pf%={R6APu_fg8۳~Z.Oj-}46}0Sp)0A*ɚZd&RDsEs|%6cQFH(r!- vǫߪ^! 럪z*_4VD~v•#{ԖSrЬGq3!mѾ\`s`7gVaYr#*1݋.g%,&tp5N{B=r;_h:_K]W,pa#]8{ӶJLG7o5uο^ί[|lۧ6_U`;TָfNG+&a=V#'ZbL*:k5kF$,#>>B߆vF6h)$9lxr;O; ncZ[`|ޡr cn7[x-UA؃/.ΥDg1tv;'y9 (+75rPTrDr6ĘXOWGZu:|j"(o*2Rי}/WM#K*v{z1F]jb/)$3f={sU uuuEye5=!D/?+,`RS0%+U& Ph>TS$]ur2UY̺qUv tiw3$jnfTR/&kCx޵r`nQ]j eW˜g=iT0ڈ]l[;Lw:(>{cf!Oqiշ A52O8KY犐"SD88qJ0GZNd6Iv$:(D.}4@RdQ7U+,Df-T/]lTm,Ɛ Ib$t莊Dzat+柜-mXI6Q Ѝ}Na;4u>v݋tmIsֵ#tl-tl{:6DǶd:v٘* W$QZjmWx ~$ّ㰫ҡ<腽/HezƫBe>I F2du"@!T#ҋȼDI^I3G-GjhOҜݵf 8s9hZUrk>nPXU1XgllO5UEvKZ=՘|uIrKMQ ίNc]w{H+ia!>S5{U\YDD`կ"eR0? *+tC Zq Aό6e2:-eӀxix/}Zt7o6z x­9ZE&l^V W][x2 %Q' ۘJ<åUٸ8?J9j4=Ǭȓ_A'ā21$K&l9. \2rkSX#5#k,TLL5*Dr`U&,Bs4 (ߴ-s/ ,&D`$.(k&""hޞeSyآ.օy1.˥abj`f#ڇ狏pޒx3ī JQ8 ٥ .(J_ͺTu/lƕkOzM%$Ծ:A?,U﹧#H 6.gȠ nh]E.D"b9L.TDo/I3[$D^V@& Єl%KUcd -u&4@C`ukp׵L>Eb_jeA%΁ &l*)-=w@`+@ߥs_FDlg zDWa<;b*gէ,nd 1f. ?$Ѐ'eڱt^<uSX|݂ؾ r25OXiy'nAb;y7N/ȉOSodaQ Ffj+DQGH]Z2L!>̪Ӥ,GB :"gҌZp3_ {ežZ|o;7v覚e}EUcu4ㆮ J!E7QjuO8-'/1 Z:Q /Dy}bݽG|y=țj%wp=̰ , cgxigo 1ZgS{!F1^^$/(+$ {&d%~@lEfÝWX9/[P=1=HȤk쮑L\RB;ZXg3Jӽt u)< #6÷+,͞tƺKrxK+J]Ix9)L PB|>:-Nw20WbudR8dqci=[DJﱑzjj7D %Y`)SOL(Upz,dzzO϶m|J-z3ՙo}W+duQd@rG|zzrѡ7E?QYf xl(W~:|zzr=>^Md{J0DG4dKG,!x1#֭ ]ga@8``D;IPMD%ApJI>jܫ[F>Oӳ ra T;<(x(X͸seCȵ.LQۮH^*ݲ<,۟qf'՞Ak[ꙺs>g8<%Ya{ PtO3Xɮ#p ~蚟3'NY.Y`6eְ|)]R Sp';1lKH@A <K- 72&|y3nO<>%Dp aj4$>O:h3DЏ~/`gؿ][MZ $5KhHF_g=*v+0\ֽDM]}9)QJGv0֜ @@NkcD4lsن&YL+-Q|񫏖X} xIZv|P/fԙҝOPB@QMc:UH.D7hԙUKng~LAҡ6ꈓi {9[on姘ۤ"gq*wh {?O46 -VdMi_;K 6$&l6+nKk+~K2^I>D?W~Q?@'+~CktNY p¾[0y@qjo k8[FN\>kD%_FCs +RV 1W)2FUOO a.I<𙮙#]u+R u%M`HTzQV+'s@ZhZa@9ma BbX'3HX K؆ n5"adž֍V7.-(j!Z7wWQ y@2OIUyVRޑymYTOyPFF?{x}.J"C2ަ6ǃ'=({9x(V dؿ*~;@:ƕ&/d?$'RlbFo<Ȭk쳎$ʬe~=C,t]Y@PN ::{AI̧^aH igX۳~(,KXmE9Pq9hKTUSan=IJ[ִ 6^2j&wp--ݬ0(Uל /~~y2V˲ՃDDɨa92IIfn.#{z| aVuKeEe Wyjį_d.4ZQ輪5 (56n w[^+-|DIc#]c,eic>EA 9|Kv1TEt.}8,zAlP_cwܓG:2ՠwu%dEp, ScMi=`88'tt8׻Afr zD ʶs0)X?ktcIZw^ڪ6o;`O{᰽Pg*مa3C G~{e [{VUOq7{ %?&hLq[5|OOwQr%/?%9F gj-0Dc0XӛԱ=0REBLwp :{qHYț.;.yjJo %$ɷRgK*l5v uGW+g1dNIynHcS|EݽQZW4P\$Ym33gsfA뿡0V6=C_̹a mڡZ;U7 y| U\.XhNNI9mJ# B/xW]{@k*>R:K0* P1q͜BK\Kөn2Ro]~cL"k#/> stream HWK% )2!c ̢za T{U wh)JJ"Agy\2r^iL樞[>'&RQ:Maԇ.:t}+QFW3-7ue4_ rSd0a&Usթ; :ҙ_I;o~[%>q-#A-_}}.Mi˥"X G!l2pIcGp#Wtvsv[ITFcWOIY5cs-H<+@ /N~mtxܜ;%}/޺%-\Bq=GDtp0y88ۊ|ߎpe2\tSp+I ιmQ9'+vƪ#-ω5ImG$ χ~7 t ,=++@A톑F0\*2i~žx6̮|vkcr2edI[  Y&d9WziHjV>lՙ~v{@˸Wj *WF/A^xgذnmNԅR S,hϤQ`NG5Ł-~m>"HՑR^%u4C'KHT/ITaN{?eIb%PmOb1 L39s-ڹT6bOó?bTiKX!}V̂bR8iTR9j+)`[[Ru[/kbV޳պ=.F!Wn;|5ĦTh \hk\%Ԕh[wj@T_aMYX@TKƂL!oeWY_qK߅?WXW{iL.:D- l6ړȤy-}eb9uI"\wbgkf@?Wa6e[}[S8:h D#x f8"B.S.17I V~|*ֵATd49pys4IfN%b]VE|51Tp+:@[Xo^vnDejN>kh͛kX녳}XڣO\l(ki.G#To]+hu]}̧Oʄ#R8RU .Ͻ*!!ڵulGN{="GmZ |gxLL[j`F̾7h+V2Z4|Go=`1.NZRr[%-9KRAX򕈌||k0˱G2G'd |O௠lŊ2a-K.hˆDV٪!Qzlc)^5RG}'el)ϸ}|7 nE|+ JX 'MFiXs2k9bՠ=`?UٱsVMҚZ;t3to`.O>d}CF ]AՔnd`zLg;7$wk-xD86+t4ye2Kc3Xjso+3Y=ߒQ5gMCZ-OϚ?hiieg190: lr*V#fqI^0 6_^A̞@HOh%筎)WEdȋ%פhe-/Dz"֊(R<ǫJwizHʳH:\mDݞnQ(p.|{lg"XǪpD5ڙk56Xe:q2I7D|;s]ø49`AoA*7 El&ϒ5ZhQF{r|o;fw1i$/Zl4GTn ŗ0|{o;wp~-{\-18 .-2KZF{Q@]Gq{&n8GڊwElATr Z"bjLozɦ[]IFr'o3Ǟry(,R~v_6Xe4[)MKa7VX<  ]S.vx /{i(~Ba'V7}}W\B/%}~Ō[ԔN!cn;8sO}zhʥeqnt ?_:U7y#2&,}7UeǍ>E]%g<~Uy_t`1kh˖^FE(3Dnm'H'!EUAtQ`U|R^$Rw(oxY_sZ슃mÊ/_)O*Ic= B~/DbW8 8Gg~ >ٔ7VЙ[q,:hA6~is?8~tŏsGW=`|u3K?fJ/V30^kS`Pv./뉛}{vlrǣck@mHv vG;HU) nRQg{uhÝs1{A fb%̫uAǘJτ\/"u:Cݹ?̚H1(Z2e#[ۖ,f)UcC(K%x6_o[1aHPy,rHZQ .U+-ɆZ{ڐ$LA4k]>7.E`Jb͞Y@vW0 jbi A.,jcU/kh2+ ?99%UfweȔŸQpޢܜm g+WPU5e)5}1lO!5\"f%髷whUnl9*:=S22@XWJdC յϲ I0ii0Y03޾LVC~#yؙ Two0 3 _CAl,Xg$:67{Z8վ]͇}֞n|аSYGz.(6T>Bi|G 9's}""pEJ2_`r3MZ4OV85V #~WII;8kZ6drlu׶:u'}6ʏhv5xʤ-g+Ć,k:SyOsޖ3%SqRܾTny\VL^lyrxeQ?Ms)̨CgSfo~g˛yMΫk(Q9W:W3k5zj2߬W[ƅW\kqߐv=X]pR[ @9#Fؠ&DFx&L(hG>HWVAVOj ߡߐ4)@0ˆ% g{8K ݞWsϙehKA ϲ{ig^-K |@J/~aKߖg-ن%f 3ΥfFG2i,w3_@FՓľW6l!|%sC=5eZi/mNEe78&B:Id!/Fi:cȔUzM/$tEß(aXӨYI!2hȬ= |&_Xm@r0.Ia[?,P-IfAUfYX T2QrXքjH2㉣jQU؉sJZ7x{f{U^f{ ],W(ԏ^,+FU`uo̽5MXv%snp>-t+F[F??ҀxYlըA X4le'VjS[|X'1˩RAkm)C <`7/'>@8i:§&g>oXh,@$02h0n%!gqR!@K84n[hYuVߑ/,׹*^'"xPغ*gt;$]=~v]嶗Ns)~1ibr!zkRn_pˍnEnO s}+d^^aq!a@O1Yx8R^Ĥ52h*ƣjd{XP<;5-F{B1lå0֧HaowseRgl]Fy9O(yzѕb#A]RL|qHV4Z?bvlMyfzR[ƁpG|jrzu 8RG!wZ /}`*-!iMt0:AJG|ǧl!-ԧZ-61]Ϻ mXӚo{Y&'g;Ǭ""UHLbG2uzT=I /*T )Ճ+|%sC$=h RH{iu~0Tb?dY^6bF9Ot)3rESgfB]b,*#]BBǩVZ^ 50qڝV"ħ^)/dh [no.6pn!d'K!4~yC߬usmFy.笅R6::Oq[K |+K ȿHV4/!8,M{pD# !ˠPIP DɎ!8 ~7a<2&6H#&mFoI4dvi@=im?ji?iW𴵬Pi_Z;;$,J+b!sby=g`[]bXk;(aHetN(KD-dk<~mgԱ?PE.E8zw>!]-Ok r`Y$`G6z[+./7y^b1 _Nݓu9!9g9| NG`.Of! 1ԈVUmyrTIsGy4]*WmKTx_,=f`Ǟ@{WY峸lGjdS\U:ȟdN?-@ARAZ<Fx6yOygLqPm]59nUÍX[U;Ml0 BdZ}l ɈkxN"W1iSf4I@t`b|QŨAR|Yڞ Kђf/ ҹǓBÒOx_iH8nT1FsTi~SKGJ(͍>ŗki%6s.2x?SgW+_wYe5Sb/eXG"-&5$6}mʨqFL:7huuֹAH/"%sCTy{Q^nUn{='b| )_%I8W;VF"u֞T+bq8Fc xήhǹr\O;}{g3]}7*E "}~z[YsE- |ԘC|D|\;R2U `>{ؚ*CjZ bc+]&& %\ ,P["c"iDCfW}SbWA\ˢ ˁ="[ _l ډBDmN S+4< ӝ`l|k2b)P"14\Xl,/0I?xCF"4d엿:ЃߚkWSB>e>wاM%^߹oȥ9LPsN6eɬniw&}2,hᩝ_ѻ m, (nܚ4%{jAɷg/x&2c|2chYd{-/=Cs{̍ _tvxkjiPDZخk+Xyל$uqq=ȗq.u "c_c`wc9]݁kL򃩌$?"-g@,ߠ2L|%`Gcg=3piWt-L\ `,d ͐?,mK qc3'dexs 17e$SpvDivuً:럥uG]>(`Յy^@uMSAC4<C(;2o8$]dl2Vڿ)5Wj7'U:&=(7>teXwe^*#׍u3b> HVKe K?Cjcf72ICEozԺ-+% QPR¯EG2@<6PSyyl`"TY:12!"e*TI4C4FNV:bE*3A Z3]N=iwc:CynUxM""Bz>7w6=OYZ[MB:Rtf$ȵSH-%QErArew!1Z )ŭ3WDb+Xx(.(VR:Sn&cgZg5#D0()D@Da<$>`Au=o/\fG m0_7Ji )ݐc#r l3lCp7YC%=o/A}=jQJu6u;iU M)cUI}g翏vzGo_o.;ml:b{>8߽nt~8NzzԘQ|һO::Tvh9@segsnLMM/ i =;Jl vWTѶ _ ڍ'tN*V;XwmBƚ'5K} lMTJ-tC&8$L|`Ls][ѤBlEjeVw`os\ HRfm]m)(q.iW/ j `]X\&?㡄%؉넌P[m#c4#BD͖8`F&>a:oGʐW5"}}hL}B7M7H[~F)Hc %H=HGVt`8Ӡ9/V3 ^tH^efLgrbaZȍ~N &Ь7s@UeI1z"TXd~$}_76'/n \C@id8[MkJ59|qD\e.V02B}a'?\=6/4 \N_hp5gE]ZTr?nkobKZ#׍2E o . ,_qHRpH=O?P)I_`o~ *s]:ͼ&^ rF~R͗ 4B4X#Dݨ;|qanXV,7">u,DVX5}r GX&? ll EX|g#]4@5iTx 'ApDvd458ͽQW#X9#=-=arʄ?N BTa+ W׾&]'i5Nqma*b; 8Oͷ؎BmZpGdدCsozsW=YDjޗPw$^`4?XC@lmmL]*Y)Xy+yAA:nSb KVXNbFhgl_<.>ATgٌvحF )dr?.#I]NB&6jrZyta06YsJ{}h6)t-*4v~kOno=6h(ܭQkk*T~H/B?lrlsdHٷjI>\|5iS;6[bU|#PPZ NUդsEk+6qh΢Ow4AXmn=Śgέwv=ýᛜT}fExQ/{".dg ` QQWX{7y>\wž]=Wsw&zpIh_loŸk om )s1kk̀DcsoP2c ]gְLn PCe&KA0;?· 4( = %5)j d范_667 P.LLs#?E `ua 6"Xק[o&o=JV0>rDڕA:@7>7stQeцQ&&H7^p&T|acc(.7SA77ӣzgCJi~h CgF)B9bָ6r>pt2 GG$ c#k34'[ь,f o6G5Yjty?yL!܏+7\Ƨp~RlmT^a?[w']|.!߉!$O(k}h/nO'$it_c~gXy-PwZ5Z}.en'ص@&m̛9e1g{_hTcJ[> (y\fH;o}?Gۈ\UI,R諒2~bڸ U֨`# iYYrS]g%}G$9> ;m`0,bbxJ*gF-E}ݯ0Q:q(3>0Q~Y.xp_ % 9Ju&/8IqUGn &8-׺kmzS ŀYn|O؛o;dF;ӄNt&~'@5ˎ3;4,U W`ndӳ;l?CQirNYlCī= ueZ,S8.q+t#fICZ0 6&[L+No1i99>l3ōO?nn X)ܖQiM YOK 'CxZkq)z4kr n)W{{y^_n>ţN9!הLQ&1uAI-OYʏ(Ck[$:(.`+ G=&0o5K@HdAI7CQ9 !)ovUik[^߬Rg}^W)\x2+R/bË3}V1 X^}F>+J}USr~QD|5aGrroT.|'@Ӫ9sW+E֖!w*gܕȚk~ֱ#}B(pmB3"*= o|2!HG#PI6I@ `F[%k6S>RLq=ſ *e xD`Qx핼ɧ|qmF6q~pw:G:}<g55Q sV/C:jHN.8g#Qb?*^MQqnFyx,>N#'~b\Bb0;72[[P6M9I TĒ}LqϨMFX`EˠJ#H5&s;!uhJtգܐ|̐s3QY;cJˬ`&sS3gHCJXBI(i-f΍Zu59iURڮB~x >rLp c#4qs/NBlXYgYnJ7+pI#E$z8n͑;q0]qh2BI79{h%+ MccEh5W5=mr\'s`X-G̷F7Y$~O0Wp*p;J8}UF:a2 ,Rxti `svx$ axTELQ Heqe9۬*2N 8R.1pi(Թg-yD5)-oMTJzkY;h`[dd&;0D4Eڠ7Qgm2 <+M2'75%Tޖ>n)\~X>5iojAl+V!'" s]r5JL=Ii+i-s%)̃q#T Fj5j[e0cJjĿ1bTdgOi* hD(Fk8֨ :d#BTGFȲKڢrG_Y<0wAe'5HY# QIuTil\Ljm$s.xao;Z)~d#J$ N.8տD| ^)2>>lHBK.xּE <;tbxvOG,tti/ ZY?)12,))Ӭ)fCW{l;nMl[T~#- EY Tƒka$a;U>_`Ìu͏Ҝqů # A'Z&-ujt4K{D̓"TqbH#DU$,DGB UkiA::U@1H´x [D*7?fvtè=sj,n5;BtPhGYjE"lӜC'jZɂdhU/vc8Gg. fQmmlSGmW//ʽqX]kc>wIJ= 1&@?xGe.flή9/sE6@w'KpxSL.^CB4JRE큎p]wtgDC.)j >dJ4ݬ}Cܳnic/6WT0}_\Ջ` I)BJQi՞`y_3E/PabD]`e?J)3+A4W'ڴ; f=\?I*3:xPs&_(HW^'}&i;8qTv"1bQ^IR"c~ԭkt j\)] V?e;']OWD4*Gqtk֞W-vfxhWxَKSڧ.'R^բA IK.IW܊7GwLfRϋħ;g1$k2 c6Q>Lu%#I@$%EL&nus'vGru.,@ې:0- YCr;e|\):Z~ 7~.%G1A-~/Z|K OL}zq=}ի9Njj,`*h֊scm-cO .8(S&578)53X: XLt$v@KEdbƒ" 6M%"Ic),j xQK Ŵl(UҽBVm#ˮǒ/2,c]\ԝE;;By}N/ќKtfx1M_?nIs͉ow*ag^!:Ov/^,u5XRB.QveR6uu,6Txp*A*_vn3bg$]z63hbsd_Ө@%X21PQ6Q^uh$$DE>& s; skŽuUnh5gǸi>c,(Yoi?r@m.n"XgRٹeu>No/zڌ77ՒdǍ:.$y޵7b ^w+Ԛ˞EcHD<``WЩl;LTj7tlzvku֓S>)]7+0TS9&˗m`49Vi^5T:əI:7o8'v2F26QUEZWv,Aˠ MS\9M(7F=|d_PCaVȕeu/ķwb2~K"""țfMhkD|K6Ƞ"L!E -Pk9=BE.}ûD{ DbZ^UyW ?7Ao<}<ퟳ0k68E} sx#x2}]Oߔ7 Wt}?ŀW0$/`?Ԃa)?RMi!0 FhXboE,3úrIj¡]>#Ze,pzٚG? ~{z%Y,\6 $w- EL, fNd\6w|@܁`\Ǿi@|yl"ɴ78iǐaZ',߫^;'اHpX QcS_ќS//h@!:b)?EAcTlmM@gTWp7ƀj1! 5Ƈ,'l:}X:ؾ_i r1҆KdJV͉I=BwL47ڭ%u;'@؝p';96zƪ'ڒ"AԊ5 c}ي]k'bABGXS3pg)EvZ!;YTzyr_QsU+bS%`7Zr-4Gbߢ=(FdSR'H |.L=?q"IisL{ kgm DCE7G hl|U-n`,|$4{: {Jqv!*#ʩHJYt v&;D/ J!}0+ϥ.KmbRAm1`u{e'&Txlbj0Di, 4Ҩ!2]krB7 ;Y󬎹!|NM8'1(sC;Hb-mNR4qՄS7btuR.,£PuBrR& Z;eMN[o3S?_zO4d|MQBSӥn]*@j(r:2Dw-Yy}"^D.T!HtRa|/jw^\w{K_"qBhD+PHJ!:Ǽ*f}ˆ"-MEm>"QBV"u"B~ zx<mӷ7 |7D(ұ(i@u7ne軬uͼFo;lwQ}*Թ#*^Иw*~"{Y,?Q Kx.Ulޙ,I(946JS=p\搲gi:QCjYڳJ76O}]"; ʿ;v-m^:{ ՄR^- @3a:}2M`ޯI[̭-h> ԀfASFtX ˭!ZFEb.s q#zOW4 &y 뷫1d`WNm PEy*8i|y(ըZ/fkdFXc70!5Szi0ޒ@5I`͡M.4syqrUʧ$iuKM"dQ00ǧ'@:kzP2N‹k؇I"CWi g?)`DPrkdCm+$4RXk\1z&Sm[: Xq9RUui,B}Gܒ"e/cHlѰ1ja!ry쁀>4xC (yjG+z{CH!h+[3~LXíw 0  endstream endobj 15 0 obj << /Filter [/FlateDecode] /Length 22229 >> stream HWI#G+$b_1o(HС0an#~H/i:+ڡ? nlJ63E]qF~̈́ ݙϽh!j=75e ]Ƈ{%D"<6PI]D$|!d!r.= ?S)[F_VP/71 q[9zN45#$oԢ 5q ͹ױ6&&,Q2̭/{i0Bz t'R+NNԁY} FKV&~OV, JZ4[wh>Ub̡ꢥmh]s(N!=*n|YFL_-$f+!P 7e' \Hi|*ta c^zL<-PmkѷDCY1ܩx%,Zdmx[RbiҾVZX&lJ)KZeUdP+UE7]KRɳVYT0$=/ 1du`רIIFi׈FbyL3elZW\bC5胕0Z@Yaw4{TԢZ3,*/D;!Z/"d¡)IÌ=2~3C6Qsu[!Vثgcu|W_1bB0])oQFqHfPf e^\G,ͤQvcF3fUjh ȩ9o =B\)RԄ!ؕה9$0L>ur'#usOb~1ş)>r/?޸I4?\;&-y71A!4)Ѝ@vEc+ Y 8 I:3-tD;4#dJ;,[ \鎞^Z\QwrBi=߈^̯F7+6 GR{#B`A\]{Brbq[ۺ d`S?Qe-7fJCv! (05 |@EȠ8 oV^C7͊ JkQlMH}FJX1!fxBK-ZϚ1aDTt?)8š@f9IW+ԔQ)M 'FBGCCۍ=g=*p.SaCofs톁\FVD =Xa,D+8E@XY7m2yr%"KC㹬ϭ'N4+w79!+knV*CpF9o\v5 svB6/ b( E/CP4xqghSc7Ͻ_Y?p~։C{BҰ >q3SI O fz=c[H$> Y_lє5e@PNhݨNDTF}jY}$qW2WK%~oDN8qЍNoJzNAhzN'y@SD>2q(/E|WWt`e#-l %Ωm]Bf܋SRq;ptCz}hϒQ1aq.bΆꞯDoK4Xxɫܰ˸`:}ApDրQ,]^'}nÒQ"#Qǂe8NYD`veϓ$V_0Ad6B3]f?W@> hYєdu@6Z"5^SؖEh?^cga(/XE2Ʃ=@voQlxg7Qr ir&C27x^&p b=a9kxʠ [V:WqZ`KM?*EȬ B3dnE|Q 7U_5Ybi*O{ a*F aCR=Y1Q6.R!-ЧđFVH7DEQ) 0 A;ٲg$SuIQ(]o!4ΤsTk+\vݢUŽs3 vi_V"i|DzTFZ>lXYl,$V@ͥBV ?vL%ˍ$us~7sJi{MU@ яooSݮWѓJ~RX\Q= O[]YYmyuHǞjn!LaR!`Qbg?)T8֍o^ְj&"JsϳmYcqCȔzZ)eymO"IH*x"+z ΦXn^T-?j\j)Bhwf,2B RlabEh!~#qƣcAM9hi_[Ii%inu07' о9`-U]Wa.Й\wpCJsʼItӁrxݝ#1߁FŎ< 2!C.+aWXH8DAMz1[)w9{.*L26s}lPU*.꤮HvB ;%5ii<&sJRvQW`D(r[AnK˪[겴ɛ͝z1֩fv1>"DQskHDnp3a#EJ@b*t2u ӓy#C5sG(?[uUi! YSlZSahxWHA|B""[FWpį7FuK²_"o֧?h@A?.n̈-<=@S=Y̅66r?Ӱl."53f?L5 vxDZyg ']Fc; -O͗HYD}h17u5inW./n, ާS֥-l^ЁJc3S\{6"Q rW3E׈O͏X^Sto?\t!{t#kV3ެZ ?&^jxx+`qNgЊb jkgׄt"`9t`0&uD^~?h<L- ]%K&>v>kDzPRge?(^MWZfuuZІe^SN;j21.>YfF&5J@¿: {SC zN+;܋?TV۴*@B2o!ee%m݇]T7(;iM&UC8v b|fS>F9l'a%0m<,*0B/=;~GK3%;y Q0s_;]qMV[vi5HY{,!@٩3B$:/2%n RMԯy,!r8@VVun%IAdzӢJ1D"he yA=%TiMgWTᛴ:_Қ` l>xw' a fVp9Xf? &D9kH+PC/puV~U.MozZ=YKVh1Su9=PVS;[)cIiW#U?ݤiday>G-adUƳ*7;ʪ"A/ut&y!hV]b׏RG ģW9poEve? o2z9ܛ͛Lsϸ[PŰe:#}Z G)Wc<tȸ `vjl(O/kf= /JaO{PA$-WxF劥gz- RSR zaS|'/ *6ڥ~2|RDj(S9 ]e>h,c>Vǎx®xf) N卆5c§w@zQzk^+ԋ'Yݧ .#P!^BG. ]j6~ D+LlzLb|(@쭱nO(VJxjq~ ئb¢vv KYa^@hN'oɩ_Q .6@,T[ܑ_DYRe j{OR&)8]*lFB^DMKh[q.F,t@a ;{>@"a4gk3 EрcS&U1A%-0yl]nO%瑗V MW2)'Ιbb 3WX~6'm_dՖzӹ^ԋɩг>wOmzuo VUlkBKԥ1EHlJvV ?5+WIr$G+žM7DelkjڌV:3# W^m JLʉe!aBؓV`SN/G^`~FjK3ZmP% Bj=K=T8td)r9, }gڽ>jro=o A]nj|ׯ-z$XhđA="Wd5sMVVOe$Mu/T; ]8toTK jx2Ry,Q bɨ_筮)WeXq &MPiggb#cN8(xy3<\ϻ]|,ӧ5AGFeAiZ};PbKNH>}#^൨PBXq=Jѡx vl}H?}'wR@/5|˱zmF^jPE8|a+aê)YmDS]&*P)sr9(y SB%k|_;syy~zԅDsGՑT0ϱWcxXyQN_æoyf؞бe'y_]]a`̟J/ew(s fH!ɴ5ZO3KqpHߙ,;2 WclI}ǵNI8' t uQenɖ[ eeXMh![in4:'lx~\65Ns RNYMԻ?R(- QwɅ=0؀6I(#%G2rfeZok7_dc+Guk]Kt+&ww2Y`BF@i0QϳyzWK,্Fe) ~'R{ IBUe12)͚rPUs{{Dw|2Z}IՖgBMqڷNjB+sJ=S}Egh\(,&, o:II }60йGz;.3*.BBO|izknj= ~*HEOpTY[;e&Ó7{[z7A6)m; FmUMO c.4I|c=f_筮)W%=BKfus%d~{NjzrOO'>oz?_gY֟G^m̃9w͐^nq]F/}דOҼIQ'"Q(+S֞DUJK{5"졋m%+ep5 A0Z:sؔʪ6cn`JiK*ՄK7EH˟isnݡK^pL'-,_ow* ?E$Uƨ94Ĉ%SK*Õ(L!ƤMy2$'.5(V JՑ{;1k?ϵ77,r=;?T|k~]Au OhRoA 9&Hlu4R%QI]wY߽ IT\ qP+YlcTC+zY[<hsX:`=r@{"gEpwz5f;oEFu^1-47k07uCkn}+Q'Rn~G-!P W c%EOCoQPF$^stgmI O\膪7( 2ijg2E/IPo/7q!Q%b}fK9d>D.I.N Z 晭|ı֕ im+ >#U(*5e c0WZcsh:&ĥ: Nm r8^(Pb?8r] 鼳zy?{[@M:߼$='5+L[=Wͷ$"cV }V&bp.!z0YRd`"gVzڣ9N.zj Wq~d7;h ,ٕfO$lf]ƝF`ɉBrf 6H,;möK.7ԠmdQ^QJّ!.ؑ+{|L*c̲6:ZYݫ\ =B-9^B*kZFfLC SC /'kX$E/hXOQ|)˛-C tj?vc4O_;%NuEр)d0P4tg !Bf/n73/ad.//ׯrO$߉sFu+ wݺq_.o?뱧ijY}zpDMa awD ]#{yDԅBLr5!ļ@rG\__NLÃxӧwZ=u>):V#reRgVnl5Rɪ<{薕Nn-Vswn)M4j{oc R2Z*zUMkߋfH.B{unŹxxkVn0%zMvv"YXSw*{]!sW7]$દt=׍x8gK8٥Z3TXɩɐd2 iDkjpG+O}gg6ޏq0eKg ]Lm_-S[>"ܲt­&ڈksO*)i&n *\}j&o58p"g]nyxb+R7|sΜT(!k0n(]CGI/F{1,FhQٕNݒp=Э7N@@;M̏i'xumk? W%?}W}Ku}=HN= fpNԗ@H}r* 2+tuM4&}5PV{'a*`&'[:_Rx,+A/K(@"/g`l9=Sk :OS{t}_)[Z~)[z8OrזJJEWL?3I0jxNrޘlGPh`կAm`4dJqF<6㚩>nTApF2sdz E־jػpOZxXvrf S /+au* .caN]oF^bĸcn2#Ъi3i t,oN0Q<eFՖg)g3:RBT1`Z\pL%i3XRf'F?kx8$'v 9lԌ5f# "546T%;Y۵YNY9Qǔ$:I%Gec;'VIyG▤`.TUlFr*lOd8b<2M߲lE؍ܒKOnQtj{ "J$׀ޱƵ/@{l k5/ٲ8N`J )^^ /&@yv;yOx.UPm_&mWS*?U[kj/(oaI]/bOUd_MZ5O"; @%I%Tރ h`1 !R&qlq[',cP'Z0Y5"C%3$3xFsCY&,D#`Wx㭲,Ľ J|S?}4h*qTSdi޺rfTcZi:]53T紻st٦v7K5v݃χ("r{E}jPNӥ߬ 4â΍Hq@7;/'}޶s}6y|$9OmyUn|4wlm4K j(it{Q0V+{m{9⦠{mvi5u>XګR,U0ao>oQ>]*k݄ +a;!8m0hޒcvn}̀P6~e9ԣr.$υmEÿLlnlPR͕TytxRUٳOSv\2!n#,S N UTajNqx0b AB8p@{ޯKMFwhlLNl" n)d|2Rt>*#$r~q$8š%reKh1?ѱuǡFq"gG^_qXuYYv+'ܑp۾CoA\U巔k[)swkou g}wMhW(4 WU*tX1Lzzg9R {ʠ7 Z(6x@!wt5;821c,wѯ:0qp2'Jx@PuP`֐7lOp]nd_O,کI 21@GjmB\.{k>'b$S$N _9w_ї 6# /wcRm 6Ñ03_6B}YzBkXreuG|* GŽ0ƽ!JѤuKjjSؤ\cxٙ>i zAY[Y5)ZvV5/WIK{RM,?a i6QF6Dai P`R h[w87q|? @QyHƴ^ps2sHhR}J6DQcN͙H.:`:K 0KlނPA ͗ HBqDâmuZUeB5’)iA )rY2HE˹$w>{Ie[PI%X2'ӪTnb$yt 5 h pdUh" MnmT}(޽b[Ї'8!DIF!|k|HBJx5('3P@)S]"ĝ0k G8ҾN]^:\4x3FfTŹp5YRnʹ YrZf%\Q!l c_jvnm̿(Yn}oX~4I_.8io3l t*5 e^kcDMh)x".ӌd*ۂ_<^ mj@A7ls:w$\rs淰A4ua^Gh̃s+$?`{ ~L-ulsh_o)}<ȃeLeR ٝƂfE/v?|B?j6SAl^ЬY`d?h+r".H;ZYkPG45GD<ͩaɫ% 뢉~zd3GmkcjP$;L`vD5Zk57J@ɚE3%7 U6M4y5mQR{ׄo GKT2\tף$ݗUw(Pv S4~|I$ܦ1Rto+^~Uv9j&-W,d&GrB brIQ[z MZ@*s5J>G(kse,_O0]O UM!`kt.ޒRlG5 4߼pV4B$VƁ5m-:(hIuĆЉv%tIl†#N`LrЀôr*SY!e~"VI٘%ݸp=eWmVB\جw#͂C BhB,$/rA3 |&y*Hj' a^+CA"O W>z`UHlqDpWLr3{Yo,6_IOba8OiMgs U (K^c5&ȁ7 ~>81ݯԺw{G+U^bO]k,.L"86mX@pdNCG_˵Wm^aSDS ?=iR!(fF"ʩoؔmv{g9s,[Q69Ge9֊p2֖"3atBiI/e ¨!wui-DAV-[Z-UlR 0ftdWG۱L7Ia%UW%d,XStS\>_?n|=ſ*=U /ő\n1"XoF(={[D%I.o^*bavBU`0UM#02:/k$21z42>9혩A{%zvL1 L-! 3{"| [5ڷX,A,.5iؑ~jw}_3d+X'lu<_! [#MӴd!/&r h+En(Lf5YckMB=D0Q-\E(̪t U_~ߩ0vk}{d2&PQE6$ԥ":d|]hMWĶEP#>I7-^dIaR|J[@}XC UyEq"4=fǸWPsC;RYUb<0?)PxDTWQWz>c9$&t>{2쀎jZEݝ_j,~}T!wU3 p4DsjHZUF{ =@ߦfyp5A}j a>>LyK WE$>ge xM:O(SmLf ^I2Hj(׏.e!v@ OӑAzI:Aa++R+-jͨhŏdeV@\>fk^KlҦ+e$5}3)Bg2kuz aE`_VHN@+TZcS>,nLB}!gDʪݙLdƧKiȗ`n͵6>)]>ΜeӠ kLM}I͢~Sp2ڈ ~!i!@ic{.BG~$N$d2cT]K\QfٗZ5-k^1I۵fsG'3k]7W|-Èn~V s9!za핣7sӉ3SF)ivYeBRX@}ftT[3EF^F(}QL>pU¯n.ˡ_ J◕Q¯m8C jtY?w^t ^7"qHEWf܃"sr)R1blִޒQpq\WQ)65vg4:!f\]1^ 8)jʯPͯԱQN1z6^v "0:YeLVzXQ#WYd.9 D+f-@uJzn:R4\EIN|ւH_م[niF5e[y18j3qϑ_Fb{5F!4g- ꅫj[^D"50RuΝiDQ*TNkvfCA'%|USCY'fGG7_W &a2ժ]d:҂H /jW$ڌ9$2/kde٬DBWER;K;P_ZV {"j .ZJYμޤĝ}GGSUgtLO%tX r'-EzzVQB]T%bɴ} pH :ǎX1g) y2l 2 R>D nƌsmaƧ׬0ŕ}@o`pMv'5)Mv@Fm$\S>ؔ@^a +R{6{2JS;$)7lDL\ #xVv`ȭ9u3pP"֖ :Tgf Vv¥6858\п/+c)i`rPլv@HBdj%Hb5EҨޱ.&jSg:_P T|69'lTiz~tR4飼h:O.?g!bhneȐMW>:[َ:а>ĵ(.$(j8t@XD~,hW;۾1׏Ix[YxGI=A1;l0n%DV"baii޴jePh؞4zl"z;LMb|R:ۑ^bF9\O^hԘyc?uW\ojPvCK ffðFh8|?zOU?_?-B lc/!#7gƭ|ӂby_N__,R {g;Y~ОgUO$A`nBu`Ǚ}킸[T9Ɩ~g2,%F..fJ'r4,(B*=[_8W@-`M킨{~ Pw@q)sE#㫮@o䗡?2{)S%KZ8$j>:2LI2OJ]̡jF=5=$z}mUfm&"gWWO]OWI*}6-{ȏ7ڛ_A],sg侣,rdz3Z /u=<|*[WPpeq@UR ;7SYԃ=j: 5N7348p e*GUh%,ŁtU ENE l] 4j(P>a)kʢΝ9݅YP.}X{xIл;Sr̀C<- MT~8𡷄̽2gL?X8y=\f] P~: P!50u"uey~sFo>ՁӁߡ+p7yR0 rTЕۣ*@Ai3޽}4FkZ!&%FTKfY -͸;Kk𰾺òLfhn&ee KDDȨY3[)]V3.e~j Yr݆ p.>\k$~A5`킈NĊ#T`feRނ|I[u9.#Ȓ!^iIkxrV֜55ִBq!ЅچٮU:srәgy_R%bD HJج^Bf7wSKZKx^ ;="WGS~س=_ٳ=wi${F7{YW~b,^{@?_-97pSQO0E_Af떠 0WU#aи)UFlS*}"|:5 Z.masڳ x~v4m~^hxM' m ;} ̲66-hgP1H}.ُv 0\{͍)?eʟ"S ]ZћmBI]pE AW-g~=r_ñwkWϘD˙{'bf%RxUdlnW-綋zPE/ջRƔ :v #iC Rtw(;~K.Wk$圯p{B_s7_'̟-s jlL^K!MϮ4F t| N͋arq[UW9Ot{[{TQJ[L}!ձtYqs g^nVy_2l|M M.T* x,,JCw"u3e3t)ǫˈk?-5n*+~%WPL)i8xd_? (uԥ::ȦGݧg o A-f2 繯#Y =ް/MlrΚ94kS/0xQGA >˃ g_*)-%59Äػ|ZS6f"_mZ/w7_/cC3W NJ=/ q')=vvbd*g:V{ )"m Kf\]0@a!"!)e"zDoqީ ȬL)π}鲭M ?ߨ+C0%@yi+Bώf89y "G$wK_rۗjpWn(1ȡM<^k9 >\"v([Rt.k734%l>G_/h:Pz:Igq6Дp q3Ld3C`Ǽɬ~B`O8>TF to\麇_.l@Fz+{┮$;*-P}USVӏIAf`.2ƣ0~E5SJIj`D.۩j(ԉ 0c endstream endobj 16 0 obj << /Filter [/FlateDecode] /Length 23221 >> stream HWKC )|K\x:cEq~2oBWiuyq~_ߏ_oGE]K(=M!U xep?~~}񷏿|\[S#}jC󲇕O VB[0Sݭ t'ԜV}W ¦Qz"?pko.Fiv H ըG=f~RbU}]MB㣐dvf5 Ԅ4K/;SF@K*Tߦ!vkN2V{n/gJcJ(hU&h ~W}$cpbd8ݞ{P U7ά0Gt޴h2tx|L@~au.bQ/趥S֥E9!p9)d:_ջ78C2Eo$%B9ewO٤S悀 %*\$$L1pi+[iv0%.7ȓTS}D> `vgZ*{ݭ 0[\|\p6IYS_ MQEi͍`<[磉lҝfeq1#ZkDs8sxqܤk5)JJ=0ቘ&\ZF6 oLm47ȴQS+\ݚ:(l~JY  ]E&_6jM=Wx[,A (ҷhE2w؜ͽ͘nM\ GCD_knptP]IؓGPmy=x{ѠT3PXF~Dc%?cj}3#] 4V.p&_i @Ockd*A+TN$]n7E!5Ѥ I >gWnqQԚ^`m~з2'/>V8SWCs-pV6 loE.TcuDq2Ʈx0$)"v> 7ӷ $++h3lt̓A8$/FtF)CT# 6i.sӋ1*9a՘M7B7e kA9l?Dk9]l. yt?Cy>4fbԶ^f4K 1teA CfxcXAuu]"p_PO~+}?3IjYG(#b:4$4yVEfSiŨKH7 Tu5k;]r` ߩ6 Dr3[HS(s^k~O5ig,dycH@EYV-AYwuK<4YbL>h-W0!Dll>e~FwgFc3€3%|K o~_J CSp6b<_ғ+ __%IF>T rEDA< w QSőtRlix!H~ v[Tܘkreہl v?IT KiaVC&+~iӃ;Sg-l P|:A^ԕ kw'5HLD!gMHM/`;Qtb)"QQC@S{݃$ %V~;)BbjQ%2f0~6M4rH^f2OPBy~v[?ךRRa9C;:Z;0l`p?Hzޙ HwTwS/3c}4k_"s*&=jS$5>,`(! ׌o*7hpbiB+0sdW/%$%ޥ gZ*gކ_`=!_7vd BHrM+(L<1KzҺ3C¨~}Znݾ?Ͽ~%L`)iei?V\?ͺ<#/YIfR?m,M*ݦyȞx("t7+6>*\3g\E]GܘOb.N Ր]"[<*O1A<7F˅5hD8FpᗙǺ=^/3TҁjZx*~ >5p-hmlҌʴ`F ڕc *FNh6ro-Ǒ)jq x0KRKc7kSUL& c@)٠HgO o[}hhH!uP͌snZMt;&XŠI^g M^ۡ4bYJ뉣r/pȤhߎe /ykZZ P6+ˠc)%/Ê HC!$K" sڧJ Kj9k^YaU҉ EtN;)I=w[Dވ!nO%lFE&ΙЩ(.qt` {hGG@C@Kd2Csa6x„NLƞZjM"OLQٮ0Wa0yRd9晤K ;P˦G|kI- m0;uk xsIB;_jߘ%i4uCwFD؇*ԒbUc֨No+Ϫ޹P2~(*]_z\ ,3|Ñ[91K-؍y8E߭!6|/ʸf@`EQ QhMA)[jx: q6=H*:?o2=:-mXㆭTDreM,aYYȒ1ZϳWw-E@3mŇ@nq2#'m8V4b?I4s Bnj h3D=|gwȉQD4Iq-cz=D-!gf>՘bZŊWq镕C^Wݕ"# !Gq_ԬT5YH5Z;XS($v+Ckb-֭%Khrg Y#6\bZsle:9iJl/)nP׎"-S++rmW[),`wS@QWٌ&Ϣ6mw Q .\M!Ywʁ'- 6K@ _(R (^~HcV`o\^)]룍q;Hb!"'YJcT |t7_9F-5|k`Pd#lQ 5 1`G@Mv=p ]⫤A,?w T4`e@26ѭie(qcC=<3F=8~}]vЖ1q1հ9^p~@rotc';y \,:!2Fɰ R q˶E$'xv08l.%'7eae7T>[/Gn)ѳ؝9rF́ p8|'pLV<[#4,zWop- mdy80- nx0U9kͲZIcQbV]7mAA iaG["Pזt5l|0Sl[Q4huWL=9Q `Yg1йYώèu[oPM4Bi%l-[0M!f7Zr@r}4y'j\- 3._’;^ 4hnqu*< so:D%# bP{# ~T@_%3&0x}@mnqe@e /nfUFw=<3F=8~}tz0&s?!Em+CN:27~::C6C7 `9#B:>y)w:ITnEe?#S ^/\i0y4 *%1˺<@{~= ](Y.49]Yf^vXXY"|M`?h uqAqia0k#zaN$ߝ#Hۺ>]# ZߡS;AAHw1M(iBE1˳@׉\fRxL]-yw+Kw&9} _s wפfaorE I;dFb# 6 *PFAGeaB򄦈Ӕѹ>4T/eޏK5vP@q>a?zXn6e$~VC2+2 7uΗކ=oº,cq mo\!E"-ap&Eh"YZYu,B!Ü#f/:=( ـGLf{ :О[>VN#s3%_2AKm/ X^{u۪؊mBt 1ɰ}{eYn^6yEI4)eY P$!NKc$b2dt=._$]LeJ $J%':vOipeQ}h_PK냵B9=v=͕PID*CbvıwePaX`-NmV[V#+ʴ@+xٯ&N A!Bi厶;x>NhD4*E51DUYRi`S?~qTJ;aa2/(fD*Bȸ68M|ON~]~]Ʃ^, G&ie xV~j<ݲuAvI+)e+C"\9ku-` .ʶdUb{ɬBht~z24ʸ&06ㅞ0X; A [וyH#/^lGpFҴ2G/ =v`A'0n pB>-ݱ#n cl!ZGxv}.4x3ë5KN dk/7Gt]os5~{^cK{ /=?hiTuDsm.nCj9 3H1*̒~MMnax?ChNڕ^!sT2?dTBt/ '+oú+L\3f葙[޻-1ʽD-)lh+qqQ鞷S^']ͧIj 5< 8M5b7P muqׄ;[J27 M:-~vSmyKZ6YAM޹zKt +$ ^[wq@Y(%çQ(T#шѻCkguiDG#'0.r-D P]"5K{asPVUai]Agԕ|Ne0 ]zLZ<ժ(#bz{1\o{lf33$|f`s{2l3^Іbe7XvSA,V Lcb.+j3Z5|2?&$Ɩl_/5xۯqfɾ)Zu9N),B?:١!OFf̎E8LrB7A/8sVpRQ=^&s YApP,$Fnv>C:7DSXUbW]|#|Ʈ.~mm-!m:6Obw<.AUqA^י|#FZ ܝI. Ȗ3Twl' ;jST:hJKvʼn z$|{1U}B;E`ԿMoQ1hC%d7{B^~8aqRZw͇J<HD. [_ws?" d*xpR9f#:p!ف^v~vbc=m҇1ҧIՖǍ P<GC?2 3L2C"r UY EZVJ@ 72)7 1J<(ruaJSJ4xv%^%rY{lcWJ>P UnO(ǸY}­0G*[n˾q~j*y@RYgVլ,$`8NV^x  Tor϶%7pu4ƪ!Ӏ7Gߺ|Fh c1]#Y8 aH/-Xl_˯\| ^^s?ݱe `s-YԵnw70ig{ύlT)O;r(qphU PeZ'4[@&a|C{?ѵ4۬#m֎jf/aO^<"S5yce,Y&YA:uVpB+mruTi( R9c #]!<BGpû\",Glwdezg%{ s-f-!)}Θ5+XDxb{xKM/8jPziU䃀\:#F;ڋݢ33usԌꑴ|(1#bƟ9C/*PJve$,Z"~<ǥaO'{r_gWk Z on^/!H=GݿR&1ldVXVnh0=:✋ kGtEA運䜬fGvDM8` dTiy Ps]ދC2+J˶`r*K Ն,ÄNSLhAY.Y)MSF= I69ZUs~NHY&y,l Q;r(rW+#"b٬BPC~^(̂6m90G0; MW|Um,9VZ huKt.m|߻x! V (@␛u*f ,{1!(g˚Tm8xhx(.s~?Ƭ]ʷ~+eAuXB8'~{0QU$}AhPdj<|%TQLQKLA 6㪎, Vvena-!&xdM@T:zٙ״o/b,ceWcn[<$lyxKr!'yr~ғ˒?wipxrYr n>DnXVqSs|QַV#UwU^rw<|n؂[EsB8bPsUׅk17h0Pe&_6ae#7/I3;>)Oڰk>]z+lEK];̶338=lߒ! WOR0Tet9XϡS2{*G$V P =V :c{,K)ujJ%~P-u-ָ xҔebM7R<{l}R__~OUœK⩜*j LRaDlW/|>*ƑTDqqq{/]2v8ԕ]fڿ`򔪅z]]خsN~3Бhp?4sޮ OW_l dimyO~Ŭ[tFW08&k,sOyZ"Z _Vv"~4ެtuy8h?Μ>1,ekkTP<}{_r ¢~Xʮ``SrAL# "$(Z;H eZa feL +*dž%PY@ cܿKBCB@q);k^%b ۨ&A:yuXy"al:F7gSY,L?p(ف4dk_I5,a ,MGty!U3i) TUQM[ (tA,őˍ!ժXK>n]UR!$Π,;&U)^+XBY[L;<-Jٱ]Tu]n @{ ޻wn8<ϳQQX !]j(9tw]Re#MBuRI6vh_gP߆-McVGz k!h4.B6(C8zRG^bil-|!iH!yưZc{?j ĘMXM7KCK y|Y8| Y33 InKK9R>~'k[Uí-⠵E3k;ao uKyd ,xmz٩Ӂn/hMcH@/t|Жi֝tq:|>bY6}J۹TQ. GHEa2=(y{Y^?Vf[z;h<(љH36Аuz!m yaV) 2[[|t ]UмUI(zw/k뾢e\BF<zk;U=rzWv3|id,qnc9lӝ$W WL:lr@#8E?mZ-Z#h6/MBKXjfHk :ML`֧U x¯=A(c{o݉H\Ծ̽f5p/u1kۍGԇW/tҵC}H&aEEʇ{1C16{!Z|},_чEڲpL^a Qk[ bdpCn({`Fû7@[,1L_ vڵ-qE*IF F+4踙ל( Ae8o W+D}8P>0苾LkÕ4gC!1Lt; {UE~\ݹ, v̔Mg*ɑF~E} ܗ$̡Ɉ `ԒT@2G'Xp=C}!m|,(~S}'<4udϝEn?zS(q=<ƧR< %m(B(203#RLJ89}lTethHj^mw5<Q.\UvjTq9V%7ŎFR+""wk)rlɔv" BA JZ+$^'fM!DWٲ5Pg+Lm0t-rZ`r>z}Cx2sAƝQ<3uAU E)Xlu:D_ø941UM _PT%-+l09\]TZAp< y5+fǷ̛uh " pgR\;Dy; %Vws_gL-Z{={n/{O'w˝V)x-/Ę.d:7J Y)+e"*,*30f Qp]LS.ihg6g&4p@f/4n$<rЬi!RGik=W6pQ5'Y^9XssP-Iuڭ'E-R`#SS_>Skbx?{ٯ"G9~v~+mN~/t"=6F|[X!\K qWrD"0 Ev_` "5 ! G,G6䖵@o"QD=Lּ&%^_  Vq1wa?>0QO4)096.GL84ДN~&wTL!ۈ%ymqZ+D8B7驽ˆ$6dt\NlH+lC*=b=$0@)3čr_ w}@I"kVcL ,t!a+4- 8mgH-9(Fb^ j@7v54i@q-4DoT :1"s'V2Ks 9N B![lwO0P,P*StoRIgXa8d ?ݎK|9K" 1Azr_ޒbA<)ԣIהc2>Uok.c1ZlG4)ݥ-]_U{Bע_/@lf˅ZDcsX*[$gӣ,9(=!VL&kV?v%BG-PX:{kx?^b׉I&0+pX R ,֧LPݸidx)|zs Or*FV('v=ɏ rpe2oCv!MTͫMnq8:)/i4z99VWz/bxPm阎)9c.^+Ngf#(DLu5[ąN;y&j/׍> уAn_C32߉:=5 +tҎ9T7qS4Xp;h7"D-RZ&`fNڵ WrDRLM߸m$pA{Sq{h>˲eoO zW5;2-K]pFک'G2ц4vyg1_%G}IooX63"[ bzK,Oy܃hC\)|7Ԯ]!X)\鄓ϒ ߿88[p'@ x~{~2ZZ8s\9.??~퇿ջ20=|GN{?8Zaw,gqr?$3 ‘V4hw1מCh]xy'%~=i'dR[RE/u+E7*Żo^&|(럈w*+ Ò a_g†Nj Asw>I6#6A$ Y|[C@r >Ul1!`u128w\ nl%6;*`<l@d\qF<6kjc2ܞQOu99khht~هMM!\-O.K%vǞQAHl D5 rĬ2{HqR/_Ius?=G,Iȸ2\45c^m9Ј%ÚBL5H^ a:?WKFZp8xWHe.|aaɼ>58CN^aSһI7YR#Tm|F!/"NI⾄!/uϡdaQ>KjFql2 {=sݼBSC"cF,j+b1b:o#cBG8D5tkWitV5Up Kڛ:ۅsȇ~gUtܼ|+t+֛{oyk^Sqo ' &b"$Vn^0"E%Peq5f X!ܯL2n^gmȂ:蔸j~6SZԍmFLW CC ר0`aoW]reloGF }̋&X,{@t"6=z}\U%җH!\z^U ^ϋ5֑\i6 K+5 _O)ଂWj S8Ͱ~Q)2gBFɍL9 5\tRFq`AX$43[/=@QK`[ D }Z06:SՏ9j Aړ*B[՞Sȳ( P4_8:HvԮUCdxL!NYw8I$V5b1R[kBWf&iGN.'QF7:2h]~W;j=tt-gyA6Oشr0 :(bo ;إS4-c8E61i lSz9MSzW$㺄}9 ckOvozy 7-ioiS6)8LErʠ[ܢ[[8Sp{42HTjy$؇\hpfh_.*IvN{gSlK&fcN$q}l4} >Aɢ=Y97ǎqgʰn8)짲?XeX7A>j-PeMʠ]Nk+P:"l/ѣ.m`\ŵȦS=֫NԨCL|(q#~Aqd웈 g )!5 ep3X|m}Qw D*uzȲO|쯁7|pM$MX͊}RjHKbs  ? eLJ:h"zelYwZ1п(T 9'hߪIB0#U$Z)XQCl"Ij CR!:%l=ęWEU4,kUWd9`MY|,Q&,~Om_$תrcвkh~ 5㜬׮!_xIaltd~n̗lOr&j?XڿX󿼗K #`0.{a $~mڮH,lgfiHup|k}ȭ;ZU]SMČכ&F2sY, RtלtZTLU2!CWʪ+ԕzRYb2MmigE!TZ-Q}CUkW)QL}YF#5 _.?~=7]c|V2lbI)ldp2!BSIY4Qg^?n`;? endstream endobj 19 0 obj << /BBox [148.123 480.928 158.483 474.928] /Group 128 0 R /Filter [/FlateDecode] /Length 184 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 129 0 R /Fm1 130 0 R >> /ExtGState << /GS0 34 0 R /GS1 131 0 R /GS2 132 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H @Ef[+ E0`!VH";Vy;A3B q06ekU#0 #\YhZJRK]:=> /ExtGState << /GS0 34 0 R /GS1 136 0 R /GS2 137 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream Hj1 D*Wk[ =,Pzr $lWN{0k4If4VK7pzPgΥI{Yzti "zC=Q\zD}$(͋Yk,}Y~'VH?ѣc w~3 m?i  k+VS9\|'܎II endstream endobj 21 0 obj << /BBox [147.634 415.515 157.994 409.515] /Group 138 0 R /Filter [/FlateDecode] /Length 192 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 139 0 R /Fm1 140 0 R >> /ExtGState << /GS0 34 0 R /GS1 141 0 R /GS2 142 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HjQ y&uEAB:B\REg!難 J_~| ¹!{pvaD(L14aJ#5p+`C endstream endobj 22 0 obj << /BBox [146.887 421.947 158.887 415.587] /Group 143 0 R /Filter [/FlateDecode] /Length 205 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 144 0 R /Fm1 145 0 R >> /ExtGState << /GS0 34 0 R /GS1 146 0 R /GS2 147 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HMj1 F:wQ$niE@+M)LdrBXg-1sQ[,ЀC.bksRh*lFeV:iNcB`F1Dzi4V3To]F5O# 3"^}~M>StiJ?z,xOU'Is endstream endobj 23 0 obj << /Name /X /Type /XObject /SMask 148 0 R /Width 206 /Filter [/DCTDecode] /Height 174 /Intent /RelativeColorimetric /Length 4793 /Subtype /Image /ColorSpace 40 0 R /BitsPerComponent 8 >> stream Adobed""""##!!##!.333.!>BBBB>DDDDDDDDDDDDDDD! !# #$$# #$$$$$$$,,,,,,44444====DDDDDD"B   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw;!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?O BJY<'I%- I%)$IJI$RI1sG%. 8[u&%:K 'ݡGd15XHsJuRI$I%)$IJI$RI$I%)$IJI$RI$L 3䦰HĪ;)y;}Ţ;?JOc4\Y=^a[us`l"4vkk;dY"ev)馒F?vf~7&[.mĥճ՝{ *g^%O~Ѩ"3?s7{K_54rdk>I2Z]Xqk{$˞#ԯ]fvK+mp%=]0o}md\lh74paòy;.ְ t5I'q0]PKu$IJI$RI$I%)$IJI$RI$I%1cٓ<;0=bW!m5tIMٕhO1+ n!>.ka9:=7*-q,vx!ntjsu2k ÐEaڛN(rf^n~i*磁 CuŠHy2U6^,p:"c*;i>}{vhDmh 4], h hn[m(9rbu-@h%$;US}l5洚Ç#|mk:k{3ʦ856r\z.]O۷0_D,Nu%.!@`dI/Dc;>گSgni$JRI$I$$D$IJIgu"ˁpع߮Բ[=%=!9%g:EnU`ߒWur/{x`0 ?Rg+.ֲNmi?عoGY`u=AqI b ]?C~8j[h| -n]FTbPJןyLr>jO깯gap hk>zvU:.tlcdWp3Ş2I aEf/2>Y m:U:]y˨ uh>ӪJVAỿ޺NvaV!; N|Hƴ<¡w;6g>Z<&V}xyh{, (rˮy>(ĵ4J&Ӧlp Z4RSų$NѲ:hk 8]nwTmy/ZQф:r Jpr轼k8/G~.5^jXA^{O69;AJ}U98H1+69#Ztmp;Kƾ8 L.$zH#E`-sY :1XY"E ù lQ.kKFJɵ]kI^Wb:ܧ{!wgHIOCNN;2&H x)t3 "'iok֐A&+cQ%=K+ rZ7$pw}֡INRaŨAcg\͘Ht]~1kuO1`ϑ\~cVKh4ױ;[FpS^/kos TZmYC))eorlz,.n&bfθq3+~)m\At¥YU IOK?+]eUd9k@?WH0YoKf~ր4k:N}Z{û%=5TKC*hhh>/V54U11h.vD#I$RI$u_Tu$Qk'WdSf5ǂA=6}k&C}yI1/a$Z e-eUGµם]).iV/Q&@Ҝs]AAi-qƄ$ \[^Cw$6vOqT <:-̇S8(ZX7S OJc.}uzq8 txsHv6VZ̀>-%;x+3,>M~kCgj IccbĶuGſZ:%2I$I$$I)JUux%=LdXs'/?]Isx]:m] N?t~EźO?'sw9Z즍||v$A:#`kuP6 :暫kXۋ m qԩHaۼ #%5zeфuShדRw ǒyWؒ"&NO( d$ݸd+uiDnh:UZP=.z[L*n+NhMSAk7)JRR&BxHpRS֤H%I$JRI$ӛk  ^ YF POQ%"h$t#Y^џk%]J*zmO$ӬL f~;dF< YvIM+qkbLJ=~*3{(x 0ˈ{rkOi峠9;pYWEghaJmByUkb[1TìI)) #RnSA%? endstream endobj 24 0 obj << /Name /X /Type /XObject /Width 118 /Filter [/DCTDecode] /Height 114 /Intent /RelativeColorimetric /Length 2657 /Subtype /Image /ColorSpace 40 0 R /BitsPerComponent 8 >> stream Adobed""""##!!##!.333.!>BBBB>DDDDDDDDDDDDDDD! !# #$$# #$$$$$$$,,,,,,44444====DDDDDDrv"B   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw;!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?I$9tGk4 dž^]n9X֍)sܮp}i˲YM^ߤ+n +x1!8j z_SzbNu.147Z'з(pdc<7آz_ sywd0X=$|vݣ#%871 )E1ҷ -9nH#bt.s2lw4*vhϹ.ޯqk!C<}i9 n4Lnvto]}2}-4QCz>VHXC^"A>< qqz{HVnK<~$uGv=/ nt:7zޛ)[t0}[ū,ZamqkU :cOP.6v]%!vwcZ-مݩhXH7cޭ+kt$IJI$RI$uwfeۍ#+Tsp,nWVًK=#[i>ԔC 쭕L47"o1-"O&6[lH iZ+22YO70~??5tdő,s]t#1z-ttt/s_\K:7l1hi?r,:]=솸qUZ즑UÁ#e$?d+ޫc1c-U9me JrK &crJNI$$I)I$Jx9P6dQ+wt^}v1nA=m{Aa~+I~~V3}7FN>힎ÏIQ5oяoHuNigyWT1uLzM8ͱKKA59uu(24|j}XցܒcZyhI,I$I%)$IO/Y|\/tILI$/$R=RI%:W?֯[I$I%)$IO endstream endobj 25 0 obj << /Name /X /Type /XObject /Width 118 /Filter [/DCTDecode] /Height 114 /Intent /RelativeColorimetric /Length 2573 /Subtype /Image /ColorSpace 40 0 R /BitsPerComponent 8 >> stream Adobed""""##!!##!.333.!>BBBB>DDDDDDDDDDDDDDD! !# #$$# #$$$$$$$,,,,,,44444====DDDDDDrv"B   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw;!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?I$>f[wEc\t!: ˸x΅]8V \%8?Wm#'%{}fsMM=]0|{q?+_m&h丹OWz޳\/M?WM%8WlU˵rG\<]3xS^#?Jr~tz}|+],]7K5uL6T6ϵ<㐅mkS1[mnkGlA.I$I$$I)ie%!fM $o6tGc6#vՊ?s ~>Jm \:B*x ܇f[hy@ N@mb\+x q=#N{uΒw46\{JILnHlt71d@-e[\Q$È.%ʰ$IL!i?XI[v]4ʴ }e&MA.I$I$$I)877CM@'O ?a$%w%pYs=ٯkv 4\5+Χ׿)靁#IEI3zH`s߲ OHG-Z`watV,e]2K!%4Sɫ(SAX\> itrɰiuQ`0kÈ^emk[P'n3撛W~EbXqObX>4]W~Eb{}A.I$I$$I)^sk>ڝ=~oF`DOa;}Me%6u?}Gu \\|WL//ٍq; R9>H`w\ְgX 4f1Ŏ28J/U7}n@>WOd ԻMg]-u,k}iqrqhպomT=q;:wT\~@'}UߑY\"^F#$I)I$JRI$A2Yl{J'vN?+sCZx \D|te_z%:rGe!L=N/76~ԸdnkHnPF~KwH:Y |kpʵu6ѻ9?s*ۆcr㮿RSԺEy5cwZ[_{t}>d˜{`%[Ǝ ֟DqrZǦëמJw*uV nl՘rnm=<*^Le%:㶶K :]*kkOۋ )clj5I%=rI$T^3YGnunޗss%s;-bK@W:z['ʟLç7Uk+Ҳex4 \F+x0R?A$`$ښO(͠6DGݏ7*t5=# 6zY=d*g I$RI$I%(W[*I$)I I%+K~i$^I-I$)$JRI$ endstream endobj 26 0 obj << /Name /X /Type /XObject /Width 113 /Filter [/DCTDecode] /Height 118 /Intent /RelativeColorimetric /Length 2647 /Subtype /Image /ColorSpace 40 0 R /BitsPerComponent 8 >> stream Adobed""""##!!##!.333.!>BBBB>DDDDDDDDDDDDDDD! !# #$$# #$$$$$$$,,,,,,44444====DDDDDDvq"B   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw;!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?I$ִ5I-/*fџ!+Zn{:sqjvZ|W)W45#R>$uSwU\iT浕5*7NH]'U{1WP '}tH>n`7pQS.,ܾ3Yks;Dex}b~`R\vdb/ u.u ~ܬs?I]7[ Oigtۃ7m7܀>^$IJI$RI$?Y\ԺV?sqyRWёc— kh9G֞h?Z>7kBH_cupBٴ.J)( 6Qc.c?oUY sݴCDN:PŹ\ź!;WG>Cܫ2(q'X*Jijn Itj$pHi}~r> hp{OJniߑ$G[V~W7(%I$RI$I%O6A_EHCc⒝as:-%GBz!?)$JRI$I$`gG<V-=p?ޮcm$"ʹSmHc  _]mv(wSs6s!.f҆AKua&A5]sYdߘ*-"=ݾ ꘸8Tn*L8vRsI0@FSzfz8VXs=֗@γ6G8i{ S gZkU!m-.AO.>))$z'@r­'%I$I$$I):I3sBW6 I(Y@kp/^]cz vάrJE[?;ds0ҧd;$:[t[=.q$.]k+kmq{6ɍQB}6GGV?*OD.;/k&cv 7uq4S[k rJqd+_#IÿFOS?O523Ē|VNуMiw?ֺ%g7{1ߑ+=.ܢ}cPKI$$I)I$Jp5ȩs4pmNjo힇}jj׋?I)M>S14|7\>OzOk`ձSBHy޵ҮeXβ!M?=_C蹵e SY0+kQeXM͑ /uΥ+ƽ{@hiѤG06[k@cG@ZŰ Nym6hk%0аKHE-#56}V>n.mp#MlH?rHzO&OOo?T?|;sK\Z*OrMBCK! )ήRSi;ޕU޽LuoWE*?|~?ܒK16>[*oϲG뵕ʙYzY8N;P}Bf9?J~ {TI%)$IJI$S}k6b;t<u| I!a_~TE IKC|SײI$ z$:I>I$$I) endstream endobj 27 0 obj << /Name /X /Type /XObject /Width 53 /Filter [/DCTDecode] /Height 53 /Intent /RelativeColorimetric /Length 1170 /Subtype /Image /ColorSpace 40 0 R /BitsPerComponent 8 >> stream Adobed""""##!!##!.333.!>BBBB>DDDDDDDDDDDDDDD! !# #$$# #$$$$$$$,,,,,,44444====DDDDDD55"B   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw;!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?}Ƹ;ӺGY70oeVd\5}d`mƆ:Vukdg't!c6O+z.iOBJ{[[U`k{.l}T.9 4;Q/ͭ>̷{ mpir'u/W{m ⒞n?~e%Gÿdogf 1II>KzY~,zՈ-:oocymٵc!A&icKlcVLDW3gȯem:Z~WM׺7ⵯs,qx0:߭VZ*zpn81kdl}oLglx_Um61#J))ٟ`[ׄRh))zMA.7p}M,8D$Ϫui8.s۴}įFށҒvMR/}AX:I: pԋK`nZ't _?SzJIy}cFķwA)$ݫJzWq$H^zWq' $W)_ I)ݯI$S endstream endobj 28 0 obj << /Name /X /Type /XObject /Width 54 /Filter [/DCTDecode] /Height 54 /Intent /RelativeColorimetric /Length 1139 /Subtype /Image /ColorSpace 40 0 R /BitsPerComponent 8 >> stream Adobed""""##!!##!.333.!>BBBB>DDDDDDDDDDDDDDD! !# #$$# #$$$$$$$,,,,,,44444====DDDDDD66"B   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw;!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?v?Zo=BgAWȠ LzuTְI;EI[͵?@A,Iߣj5RE880.SzmnƖ.t+z[a䔟?=ޒqpRrVwX1ӯq@ʩZy$͉d'W2*CWVƱ#kCӻ>ϼRSb# eOElyk 'I%1I$SKl~| kJ׫˽u\&Z{O7V=]D,VE,Hs\G5IOo-o]K2[˧{r+49-y 1 -=I$ endstream endobj 29 0 obj << /Name /X /Type /XObject /SMask 149 0 R /Width 104 /Filter [/DCTDecode] /Height 121 /Intent /RelativeColorimetric /Length 2168 /Subtype /Image /ColorSpace 40 0 R /BitsPerComponent 8 >> stream Adobed""""##!!##!.333.!>BBBB>DDDDDDDDDDDDDDD! !# #$$# #$$$$$$$,,,,,,44444====DDDDDDyh"B   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw;!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?I$T:Eb6=qВe ,o˹qûNaj8 XMlvy:UKz4[W c ][3s?\K^[xNo,'GFFׯKVٝgȩ⼫о ǷW4xBJ} =Kj76 ,s| \G+2]spsmmUcwRUjI$TI$,e,D@-fkk[3t-ia/ yDL?\gTXk7Bϒ(z/~Gޖ7r*:gW?lm{I% ShwnEolk\67]-+W, A$$]-2J%o5Waaǵ ]a؅)4cgﱮĤWZv\W6xyk:8bVa}JHm]I;87d=V"?uܼ8文?T ,_5ӹ{,gs$";-ZO)sY$2*E:UC!A*90Dߑ%6I#Q o2*c^cCu6I=aINJð/Nwqoo$OMvYR@Nq ?6+BF>دKʡ8ߞ4>^_ԨCDt ucBv%?\9ܫÉ%nI 5RE.lJj~+}-kۖA~XCJ^Nl6;}ݷ|!i-{6攔M/8fo/KC/4g_A#|V#VK+d{-O޺D f㾇~p JxW%usXa 01(c;⅍$_;athe%=FWI#ٯ !p6> Sqֹpqc_D:V0@) II$}ݞ?%BSb[u$_s. x]6Gƹh>ag:Z  )1owUۼUh{۫->ށ{wGqHidDz%DwRJoĂE^HI. )TBJi $I)I$JRI$sZ8x*#; '=WIO9gWkܫWo1$Q./K͗;GX~vZI$TI$ endstream endobj 30 0 obj << /Name /X /Type /XObject /SMask 150 0 R /Width 129 /Decode [0 255] /Filter [/FlateDecode] /Height 131 /Intent /RelativeColorimetric /Length 7992 /Subtype /Image /ColorSpace 41 0 R /BitsPerComponent 8 >> stream HWSW_H Xm],q .ࠠbieM)l$$! CBd;3s3sy%}~A\2m~"â?0Y>XlţF--uD`4Zm*nC5$73M{(QT JͶ0CF?9ky{=]-Ue,6UVQUY]SWP;AT&Wȧ#Zb!('^\\\GHJKʦ*'^ʮohnRWNg<+}6._ "bH7_  xŰ׮GEGĐH޽B<$'SҲ x9tS8{v{ypw۶m˖O{ >>р:{3cӨ > U >UB""$4`8<:..puuJ \Yݯ\K!PH0!vvh<LXGb}Hv辏qݫ_p+"v=vUD"`;,'q8;{o7! #7rii驔;ݾ}MRLLttTԵȈ+ᗎ K%" f ܺj.嶶rx>o憆F/%OjN;3V)JL"HŢѱ}</p[<9ȕbsZdШ NVAVITft\=5<84480Ph۶hOA /fsrzBgY,f2;kU f^3\QjhJ^L>`lAwKvw}u{#%a2Ym%^jrzZ.\&SLmm͌R1-{1%K'ۜa~ 5=fZ[_b:f_ *-5j1[trT  9u/sn^^.̩g$cK ϙ0t`)j9\pӜIʔp;BWMr:B왛mI EQ^YnvŸѠr43%wj6-B$ȥH|t^j\?# hsV@jy ֹYT1zרUSqa OlyL _,K(.m%̹&`[j΀ +dSb@_ya1 &MnEmhRD|p(p Id0K^Zel6MFND" 6%;# 26{Ewmm$==+Q v r\شȁ94XXl }1 J&# B$! aVB2nU :xN저# .@e}~$ԌaUWP` aȨG‘Rg _H7je\=IҎebk?sC>>~;kh+HpϛZCe[Etm2LlOnsbDR=a- w6T׊uUC?w Oz4Uo *i0O ۺ|)sBsz7p6QJ/@6QW|ܙ*a.@S\i~O3&׽{Vh!O$:"FG"acs&LI&w9Kp|2B! ŖDv-61X0eB(C#g/QQ3 -NyJA 3Cgm9lM]̇-w`R> `ݷ{xlnnkΝ^mώ뜖]V F.0lKo4NS}m9 D&#ONJN?(29D.ra&|a`El[аnD3d̿8QYDp:TGtN[ b N 1 LBB UKE[@y旞99y=~)"ߴfQ+Q1]w_ (>tERXk_|¢^/bWǽQ8H#܏>!(D9-(M::E#3}$ŋӓ×֥wߝpʋh=Q]BAYHµaA0DJ_G"fF?c^HٻΠMfhlaKCjImh#_ .*B}P CSŲ+Bdcg{(E?rDv?qt爂 T<} &pA*TG%!!yj JmZFAMI)AjK30$/).a1ߧ8YvAa%ҁ bߎ$=!WvV )>r 4^$qݞ!T~(I v `Lf LZ̺ʜ42#PVc)KnpKFY$Ff pV^ HNhf,-!H-o&5P(t8"SBE)w$lQ4wrQ p5kwv If)P]|"=Ze#f ီV<|N~B)RePXղIdJ([SZ&d2a2bo;xD^v;NΫP'IYBB-}` &r[>}PUZ愐O9$_XPMmaݼʘ `.`@n Flo޹BJQ}hĭd"pobXVj6tz#@ LoOkU{v,.lM& "C8ΜLA3oe7Bg}8l*[%$V6\O޻==|^:N ZA!SLVRZ#Z3[Ϫrߟ#B6;,o|8Tǣ5 3~ drg 'grLޜimZg3Fn+5ZYΆqmA/d**OY`7K:D, |6qb|LXy`]AȫUqXA&:O"[P:ٳ9W 켌$zZ8`IDUku g#;:5pgx8]Dlݶ[v]fvu[u B BINHn0@ >p\; vf>~3>yV$J:o7#3J3iY|.#0 SmOn({bM"?pvs덺L(f&ݣ&rxA!#ioj:NK6HH.^nm]Q"NL=x|Pk}aNx&n$ݹ/q(bLe h7Rh .] Hdu}=$*/3v988?,[æWTdy<>'%.4p5:iZ?mprE9x.Zeڵ07RԟR4-sjl@~AZ^GTf<% Od\1x`mik-&M%t9粂'a9~A!QriGIk䲂.h4D+7$@bjO:3]V벪b i碙9y\okeADRѨ:<!L GOZw˓S[u~_3)1yŚN^2YW=4$\z*$@Jţμڈ4*HN|AqWy'-nѠkF_|֎Q(Vh<SW4γtЩ* -|EQy,W$Viʌ fnLhCEwxI犩 tu,ٯCj'>H-Kg\ gC_qb\Yr`,5Kq|# 8kE"j mh5PN7R.(5p>t+5[En;@\޻oˠĐ8W>#K/ZԚzFgl4P[(y (>TJ2>93iw ݻiK?ea ݆:DKҐx<)"& aλt2$-pZ,YV?V*4y Y5uTNSWQ+Tz}k_B3i9%P YSWOC 9PW;iFME[[TVGnwӲ*TA}Q&7t"FQA\جN˅ma+aw9{d1F-ჳ*$,O%V-l J'A88c`^Cn‹#w(hs;# FWнw4 s~XAqǶ PQQC C(oAFodn,@t_{4,8AoF&/q4+OzW(:^LVty_ )57P&oEiͤ%7٬ߑЌ&??ʋܸĶb~` ":=@xtG@+ c-, ya q #_d dkwض' pٰ#(R^Jl7//Gi.-uP%[sC~A(# ~)mYw6TFzpwΓO! rs9+tu81rlavf0=0 9]Ͷumgzbsx?Y=YcOup,_ fS\6% P`g\;M_6۬6ǃ_wl86eʼt.A2DaWft|bshY>alM@ Y4 r~ps6! %O~{_<2k`d _C$Q0c͋7xpS&oH_9sρ!d3`\BS$(=ʕ ^wMKEX69;"WھiϽ|ӽ_A g`,>@g7Nqƭ/޿iww.\16ϼLw-\~[n޾}>?{ݛSm E ϝ=p>$S`?Ӯ[700۩~;I7!g/)%0Y2K`6 l[aҎ/xG&1O?!_ ]60jzӤ{K`y3ԯ}bWSXHJD^U~Q32L}Ɍ˶ǯ@Kz HۇWff%zoOV\RPv8~8yڇK+Y{DeWT* Es":voYּr׎ sC R> B"bRjzvsg̘;E /]b57m޺}\llmlm큄^|qB%g3faW6256650spvqq0601662RʞTBX,UtuuL-m]\\=||||==}}|}\=<<ܜN27:3.;0jIY:8yFGFGDGEE阸Șࠀ@??/wW7_ f g`WTRU)(**-+((+--+./HKNps,G?y{gOum o@E1?F{k`7AM`xgz:kp]iy 7A ɓΜ9s,9sn%GFJJZZZe$h( WuG endstream endobj 31 0 obj << /Name /X /Type /XObject /SMask 151 0 R /Width 107 /Filter [/DCTDecode] /Height 144 /Intent /RelativeColorimetric /Length 3498 /Subtype /Image /ColorSpace 40 0 R /BitsPerComponent 8 >> stream Adobed""""##!!##!.333.!>BBBB>DDDDDDDDDDDDDDD! !# #$$# #$$$$$$$,,,,,,44444====DDDDDDk"B   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw;!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?v]L]RݴK%ʼKOCEez)\YJvaRRWWᾫVun'FhsQߘ\LLj!C#mU;ZA0$򒑖MOXfM66|[9mb|~ )x@T~O$˫4:p{.%tPk1Ͱt![i7AM$.-דsvGWhx^uv[fUkw?%t Lw縂%+?.q.kw_TΣnk8-4{;E Vgt\lꍅã*e-ՁO]Y 1W-nJx} 1c\qfD8v Gm0v5/%A562ٔK"]V6I~; Y m8unZH+Fޔܖo4\хn.ęޯ^Ff,x{ Fw>9Opkj-)yףSxR?ꜽywOWj`SٻZݡߋW`'EIl; >.vz9䲬}nhtFT  'Q6ѹ&v+[tLf11S[#jH:Eu68Ѭi:4(K?J4[PK>˹jJv~W3? ں:eͭBO%߼?#Z@Sa].oanN.|qոą:FnߙcHK\YcOk\I:?,*O([)/hp$m0|DNK\,w=K9ĸI 2n{k3q𵺗EwDm9Ύ}>'E#Cp_Rm0mZ'8lh' !tuRlES4m`5>/u=QH9K]I^ \A%)ygw#?!z!XdI;@oIOGg^d4఺G#w|b#tO[:E❴7_Lc6ܕuvQcm}dV;iyZ<炲mZ$%ȡz12y%>^FЇ>!G*;F9w.n~OS]A ѴS{0h>C,^u-+So[[0 DHy237bi<5`zYVӗKi8 *%깗^qq͞Ҋ@EuIN>ֹ6uoM>*}K7kN5%ִӻHs l]6F;nષYn'X![luziĪ .$GvIOWU͵GBn_𱟃\lzy$EStZPK,,#wsw) kCY#5^7O繶yu!q> stream Adobed""""##!!##!.333.!>BBBB>DDDDDDDDDDDDDDD! !# #$$# #$$$$$$$,,,,,,44444====DDDDDD_"B   3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw;!1AQaq"2B#R3$brCScs4%&5DTdEU6teuFVfv'7GWgw ?I$qo̷n: G氶Sɐk^K?IM$Eշ{s[1% O %)$IJI$RI$I%)$IJI$RI$I%)nSN'NfE6Zem6H2ӸƀD5u읠Kڇ;֖&N%W>oیo~ RBzQh 1 Yd=huղb^YC߬7|Jm[Y Nǫ"_X7:tnp—=ms}Gv&>m;?_y67ne5 > +t^3.,eERNv ǥzvݮa- Dꍧ,f]i$T 3o= 5ۚRHZV}n55>.>?Su)w=8iFcEocťq5\^>JqkC<.@~*Lƽ{ >[OBۋ>d~|Js]_f+?~[SUg17QF9Z.nDǨ _yIMwt*|1k2۱ƆQVGk^ɋ_IK[m8>a@ulA꘱ౕm7yUcdY!m`H%%Z,ٸ6TDqk^ty6c 08oIc*1\Mӿ}.|A/ k >u \F{~+Q,>RAnoU@"nw2}+o^|~o@.P.IMݧ޺>{̕U.|O %=f>l=KaS2|Ct[Wc=*2f4_ZL0{ˇޒ9'Skwٸ m-] UV- Ynʱ:(kqq Zއ~~IM򫩸z%Y>Gmd4>*!I:ڽ. \LsJS\+!F~3w]}m# 3gz4xysxIX[-;>KlAk7Q~ GQe$h>v xAEO=){ZC4Vsl[x fm&uIO{ҿzgSw%"h):ƩN7zM;z+/ wXU-?"(8@rr *Q)$Ђ]W_XON۩; \z7v5'm˸eSIoδWuY5gvm Zrxc[PvUŇԗ5{hRײ.hݤ.b:kIzim7wh?]H785`%'IMS4W9gl8U,?޷U邳]S IMUP~()_1]3Vc1q0 BT:ښ\6a:EO>X_m'5wWǹhsbH$߲nay@c! ~?e 4.q<ׅt/sA5EVTNP2|I6[a%>ҿ\< b:E_g./gzAO-U[Y#C!j Fs9sN斻{;uGS7:Z#*=b!$}[xyA;zUCf-DL*yn-m &|SAWߚ~vk瘓k灧@4ܺͻI vS굁ē=219_oxVבqx`[5N7oK<Fղ+yu+`VӴ;TuY;~Sl%==g&T͖A=I:9c$ C\uжldQܛo 6- m෍dhtIOk2jms7 4}fޥѶ X.xy_[BI{S*$ci!涖}㛛X±8lاZg\8V_?wK'.<:{Ԑ]VVc ag9x;\ٻm.!v4ee?r~{QJ*{"nCMu{\خ8G+i^Fʟ|rl?if~}3<' I$I$$I)I$JRI$I$$I)I$JRI$I$$I) endstream endobj 33 0 obj << /Name /X /Type /XObject /Width 75 /Filter [/FlateDecode] /Height 76 /Intent /RelativeColorimetric /Length 1623 /Subtype /Image /ColorSpace 40 0 R /DecodeParms [<< /Colors 3 /Columns 75 /BitsPerComponent 8 >>] /BitsPerComponent 8 >> stream HyLgǥ}}߾m)VrF qȥ0PdS2r) E׌3)T DGE{NY(K! Y BR0A!4˺yS]h#dhuutFE(2 c'P !H\4F V6uFT{kcu!QJ$ ˀaTDx4&- ͹X#dwt&JhVRBIS5?q E8REPDt{a׹NUl"Nsrl C c$Tfq'"Sx/[}<:zzfF&Jt~Wݼ|1$ 5N VwQ{7#{YFNѽ0=cK$'rDH&k6Xlͪ`s_6}KJI"g0)^SdCgFzb~2)D0߶E:P}X_e_8e M?4N%'6)UT¤vz8xO=-QWd˖{WS]k-{`i*VmTѲ3h8e2OPU͏ki&:lǬS$ZӕWe p*޲.HsjT'3rW.?[y+otq^ץN;XXP."*/&ФEX|X^_PX4+]^Z1LMj梙1 'X1j/21%ԠKLʏIH@òKvc4KWSĮn,+..r`P8*>OPt:uQŜLVf`lH|UB*rۻw,u ȠpErZ+Sat(8dE% 2T;1+VԀS+ *\Vl[g`..9;"R c'cv)^IUlmQof3Cyu`kE `izO<$!R@d({4X ޸z}Q~A،HA(<=Sqqȸ*qpve5:A'c& <"EH6 /ߪUMǛZ[RggBJP]gzt\ iAи B1qpnGJ<]c@pDQ"PB@0IʲȈ! }떣%vNS$HFPP$L`0;12REJTK%bk j@`pF&p<AB/u_> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HT=n0 "(:=C38()=YG?K/Q&  [moYCeo}dOĐlv^UY4&u=QQg!=zIwF)UZ)3^;YtRK@I̓}vR%[\Arc(Ϭ٭$z'Tl^^xV.ZX*(nHyjf>O8h(r 0l endstream endobj 60 0 obj << /BBox [35.8511 45.0635 41.1709 39.3467] /Group 185 0 R /Filter [/FlateDecode] /Length 244 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /Shading << /Sh0 186 0 R >> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HTбn1`JU(C I(RHtdbJnx"P[qK87Xxɋ쭽2Z,4.n?zV_ bTH{Qj:,PjQ S#oi:k{ks41׫:2%o/8~ mINxޭwߏ䆇QXH\7y$oy  ^( endstream endobj 61 0 obj << /BBox [36.8452 45.8271 40.6382 44.1748] /Group 187 0 R /Filter [/FlateDecode] /Length 1473 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HWjdG WtTZ"H`"08018G:Gu"MnzSFij z1qM A [}>I`^{q8S3৆L=ldw;fdfXO,ZMSܳar4{4.KyC N5wlcQbUglQp{"FX[}'E %|@пO?KZ #F̚t9ڔ36 kJL'q O8zKp[ۏ0cQK0p$+0'gA'&UFwj XwI%ƒH|7,2!%8ou#һ _=Ru1dqDu`‰($ N|0 .m b Cu:2⡐?(08% nI h0PHù0 LB<%CX*KvjvfU@7hRR"";{%\IIe u4Mr372jLY7AMd!9#=A,! [fd(8 / ==yӂ'9lܘ`Yy( f5|@[hj1.?SQ,(İDŽ βE$ܭeE8Wb0}[a'|Lk0;湟 'Hг'ԅ0IV{#TKފnf Bdg弣a+ڂj3:D͍4mO.U羻Xax*+%n<7Sl\)tQ=N93tN2UGЍ逛ey> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HT;n0E{B=3Ԇw yPīu$z} #S9Jp֪ǝжtZ 07V`-bTP15] V /ݍ-~:A"6SR SiA҅PƀF-ԘSW.Q%G #mhmbjY\$96gI\`n ٌd]Lm".aٍ)囔R!3f.f+ )gPKݘZcK;sLWr֫"FJSZVOEB(17Y|qśqc^Cށo吼C^Te ٵ4#g͟amY`E]!͵{ d OHXZ1jsINr1q[`ps~ #1M2Th6x.dbڶL`"|64*ƨ=PY̎ZeGTwR\XAi4{1=FZm\ܜkqX3Hxl6,s.v`Sءpm@Ң7+N"̀y!.\wn),a엍1a]8hh/~BpN[r:?vf,L'0NGOӫesy?Cο}Zg_$KIz&P!j6SI`\ϷCr$S endstream endobj 63 0 obj << /BBox [40.8896 32.666 42.2983 31.3145] /Group 189 0 R /Filter [/FlateDecode] /Length 273 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /Shading << /Sh0 51 0 R >> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream Hln0 Dw}%(:=C=8?PNI~8y!ǩFTd[CMY- W^+ NLݻcxcXӨ͊lq@% ;CA.8w oS:њ@`7e;Y3]S7\1mĭBccQ{ro,spL_q#GJ<_j54"4vz 3c )0{ endstream endobj 64 0 obj << /BBox [43.1348 33.8545 44.8584 32.1367] /Group 190 0 R /Filter [/FlateDecode] /Length 325 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /Shading << /Sh0 51 0 R >> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream Hd1n0 ]%Jks=4S ]d?؟ E=(ǔ yQ#͜V 0E-ģl(_~TҬ,E6YteK]VIb`VLN pmxBP0㇞#en?mUuQlqXEťyewйB\ѴY>!dZm>؍V;)g+> o8!A@&U@Zԯ/ sNLZ?ηx!/~ڠ endstream endobj 65 0 obj << /BBox [38.7388 31.9111 39.7432 31.0283] /Group 191 0 R /Filter [/FlateDecode] /Length 310 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /Shading << /Sh0 51 0 R >> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H\ҽn pZehvT"k :q̞iJT#j EgwbD0qmGl)..:x Lprnͻຝ{ !'J&ىZ-Vκ-Y` 嚇TBShmet؍^4;6 [Դv -T$ 9cU! fF0& ʇ݋/.owӽTj(&-մMS_Zk$C(Rޯt?{ 0]b endstream endobj 66 0 obj << /BBox [39.7935 30.6797 41.0537 29.4717] /Group 192 0 R /Filter [/FlateDecode] /Length 283 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /Shading << /Sh0 51 0 R >> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream Hl;n0 ]Zdhri I ԃNK)-%޺VwCH wZwx֝eY6GK2=M:nXMC^ x.v_qжdiKBKvP b9ٳ-j+Wdٲ;be ײlaG{b&AՄdj5ٲez .d}>No҆GxEG=J틋bgE0b`M -_鲦X59 0<% endstream endobj 67 0 obj << /BBox [44.5864 32.2109 45.6646 31.2461] /Group 193 0 R /Filter [/FlateDecode] /Length 267 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /Shading << /Sh0 51 0 R >> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HTұ0 O8qb'nF @xb2u>TRŒ'mo$fZ'n&)^)>{wVZwhɍ˞2khig8fq14Ȣ^̔Z4[uFJT#уŖr r3o-{#$1 ЫΞ-LCVDf;< qy2YE ] R?3FlQk*e,r3Ns?g< xH endstream endobj 68 0 obj << /BBox [43.1436 33.7568 47.4219 31.0937] /Group 194 0 R /Filter [/FlateDecode] /Length 876 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HtV˪A WY]܅ q" *(yL0$'''I;O-' -rRkZ|p._P ƫ<><Wd[({aFaX}9}ZgY<qđ4"U?RWk=}M)L1Ȁ'aπ~O@بK~P[mPk6Qad#cl~ :t<{S;^uL G`GOZu2pC&62p73g`^Mk7 + /tCaw"c\s" OW4ׁQfZ$vښ47cUoYၪ}/#R>9L,&j7d_\g|WxsNX.!|Ůn$W#ȿm,W72ֺ3@QJlM FՇ{*R,%nB-9"9S_JiDO9ԶңfȷtلHГk9g "&T&"އv,9% ֫,Bb`߈T-T4Ķ3e8ξ6X& Vt&ZldޛUK#^A!5ꪙMJ,Vc81pӭ}QÅ{lfF~hv͈qBSXsg`[= :q=<|7X?P&g:՟ԶG6dh#emp5Jb-x$[U&|^t+ endstream endobj 69 0 obj << /BBox [43.9995 33.6797 47.5308 31.4932] /Group 195 0 R /Filter [/FlateDecode] /Length 1674 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HW$7 +v,z06p`8Z` /[bս}Όm5$EO!ȦL]7}fSZa{h߲m?sgKwln?_Wߌi|?RyV>5ĺ}|/Jl}"b=7۩=3#>U$Ṽ`gLA<~Y1 s.F6\*i sYfBRwi8"wsȖi=]g>j[}h/%o7߅[ױ'suRʼ,9b,V͓Ӫ^ 4{Xg/ VKp Tk܆활^܆ 5R3{(;]qEۢ oS(pH{쳐,tD1j 8&dg% T "Ū!/{m.iy!a  }\Ig7mⱪ Ku#3ϝ i Y1!P5/.C1>"3ɑ=/uU&}ŵ8#%7s '`vi$ z4ߋʷ7fe$y/ǗyGɅ<4V ^2 I]"cHoB~S פ ˅Ahu4`G҇\agG!;ֳA֎ܛ|s3ɰ0\f}uOAaj'*aꋛ6A!]^[㐫+tv |h};v=UL!K]rOvXDRr-2EIXN]7wAUjtLO1Z_yNb ect{C  F߫wb:"ޔ7جK9QD*vyrzUeNmcdOq٠Ȉ"gx[pB#.a{`)-wL-VM'\E}HA-+gnP9=ȖK1CQkhԟe.J<(l:t B}wbB3v,l7zACc p i’Yn;w=O+Q䁹,6̪|b"L b\dP 8_ov\ `]x1MvcEa49# /R=ӷ8U-8'm|[M9:[!CNPxpe ::iGǨ`TX Tl#"Xfj]R_pZ/ruIX9 sx"B 3ui۔/u*?q y葉X!Bh4ʹd NI&ewM/# QU}ā ^;z(RI*!t(VN<6?coY^wm u}a%tڤ}Wwm";!9n3MV1^;QD^#  WKɋP}'9&6^Gl׋D(Q~_"vt2euG܇+أh ]Fha`me!T$@$Ԝ(F-q᩽A Ʌ-` endstream endobj 70 0 obj << /BBox [45.2979 41.0742 47.353 35.7305] /Group 196 0 R /Filter [/FlateDecode] /Length 380 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H|MjA u ]~KUY 6Yd!#UgBjzO{3G1TAQKop$85]g8!O0Ggh7YGʇ:u O?[%Ĉ+)1:\12Mhp(O;+pBDf%;\z(lJ !,Ar=f,<9.:s2v)FV M0)2x6 d,xT_TxX]q"h&FȹGyK;&O"k> /ColorSpace << /CS0 40 0 R >> >> >> stream HlUˊ-EWZB.p!F ȾiO3LuU|DDf~9\DcJ}6Vk1n޾k~ǟF_:4zf]-e8̎XM&]D`u_zͺ"Fӱcb;㣦՛ mx?>?p+sX.kyŨ,'htD&|X~ҽ1f[Y0IbRȾaB[[p:@\3!!z"CV\UÙW4&fqgp].ʲ$yk4,⺳7ԣx1.IѭbR2/ͼ3&Ѕ\7;KZF(1gx6n܅~1O>ʉW] PqIX3VJp~Q1n̐;v^c #acD@5Ҕl}sU`5@ endstream endobj 72 0 obj << /BBox [35.3638 37.4668 39.4385 35.3535] /Group 198 0 R /Filter [/FlateDecode] /Length 293 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /Shading << /Sh0 55 0 R >> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream Hl=n0 wBQ?E Cgh@H:\t?=zR'L5n,YPt'6JWBOnr'tHM뎇tU]ŪT8ZA]ؼ&&t=?\-N² ۫R)>R)!j/쁨zF`_#EO#/6֎rNJ6@bmp+|~9뢘w7ox?4/Hj:fR,wL"sܲ^( O1^vFOp_)ɇ endstream endobj 73 0 obj << /BBox [35.5654 37.0137 39.0137 35.252] /Group 199 0 R /Filter [/FlateDecode] /Length 176 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /Shading << /Sh0 55 0 R >> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream Ht= 0 FwB"HB24{fH !-mi= K+#Rp?5k=hrJeX=sR@T~ug(,zxo^rb8b$G9aU4yD5xqӀm?1n젃fB endstream endobj 74 0 obj << /BBox [35.8018 36.2305 39.3975 34.29] /Group 200 0 R /Filter [/FlateDecode] /Length 359 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /Shading << /Sh0 55 0 R >> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HTn0 w=^ EP\  ͞Axk{A<<_!$\ӐD,fjȳ15NMJ I< A%W#bP.8#*1\GuTp51.P)FqVvAZ2V*en<xEEܜ北WmvDkr(_݊ÊD ie裛KƐ&Q'XrխfE6$$50H<u?"-L{u-fG(y Ťi-[5[X-  Еڤũçp7şp;wJDO4U F9œu+56v x>(/9 endstream endobj 75 0 obj << /BBox [36.2554 33.4951 37.1338 32.9414] /Group 201 0 R /Filter [/FlateDecode] /Length 207 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /Shading << /Sh0 55 0 R >> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H\лnC! _1`V:G=CpS)Կ/yvXIEĭŝ9<[&ʮ\\\ [jm̥%&l[khҠp\G]QLcv Ϻ֢/?\w\{WX _8c1qG^Nn[F-i&cN p\o `vV endstream endobj 76 0 obj << /BBox [36.0547 34.4844 38.7935 32.8721] /Group 202 0 R /Filter [/FlateDecode] /Length 198 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /Shading << /Sh0 55 0 R >> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HT! >E_8Jjb ɷIHWЯpqFd3*D߸3 #Udv >0!WCGjUYh5b"l" ŬEeFI~ˮ0x||Yz;?yTRDNHM.LQC+'8/;^ _J endstream endobj 77 0 obj << /BBox [37.1919 35.6162 39.8579 34.1016] /Group 203 0 R /Filter [/FlateDecode] /Length 243 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /Shading << /Sh0 55 0 R >> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HT;n0 ]P|Hdhvri#bSJlN"fL.e0Qh.Fyt爎SVg) cO Qnc*R\5ʨ%_ 5r0mpt.!sn^MvEt;~_SVd'˷jYI(l"1Qof-3]p=5]ӿk endstream endobj 78 0 obj << /BBox [33.6802 41.0605 41.5493 32.8779] /Group 204 0 R /Filter [/FlateDecode] /Length 4348 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /Shading << /Sh0 51 0 R >> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H,7E%tƆu>_гV*7ώT"EQ$C5R~J\ө4+??w~9mUAyR -t , fjUᇻTARʎW5sH}  йM=83.Lm'su}Q_*v7x:0ٚm<4eBNUt3NЊR_%FfRhzAfhK'w'EҰ{0\Cڌ'gj7oMδ$_a $0՟vXI>LglĶA|6cAfj|8®UT$|>o%j ^1TҰ*ajHݕeu3vfxӓ "Ҩ<JU(MKEv->Z͌jB—ô`j3Nڠ-jEzZB"O)hI/1,wJ7BٹȊZ$|i`Z5|X<t*6sJ7>:X|0&dQbLڃx;ˠؿ_cvֻ9f7CxHS*VS %63ոQ2BHm9Yɧ}0LmemƩDĶgW8Bƹe )Z jnA"< p)[agĻS?Xg`.c0$~$ iX><(Τ]! vGzԷWۜSlsËbs%!9|;Z])Fhz1z6 $٤Y|0W˱ #|i0nVdFT^{')1''eaZX'`z<||>)e{gY0ifd^+6,'aG>WxqrHZ' F?7.{yn3$5.߾tx~|Խwf*Z?O?(>7}OM4<~|>_ߞign2#6Wf.Z$341Y8(fa5lևy8~nwmh\0x~2y=aL- ILBҺұX%(+i|Haǻj{*U1lwp#KoD7p-K{^,FzK#]9L6<At3auObSff-fj+7^ Rxٚ c' j;Try!we7T^R@ Tq9LqaaO1&:1*zcj!EH7CT&:m.兴8*0 |1UBz0pc ;=Yqae~Ri2XoL ~4ZK'^p}#/71::+ToSTn%^]1(EzT2UՅ,p<+(b㺹QPg-yͬM ꈅ7Ik=J]eﰵ6zp~vXJغ9LmccnZ_nY-.^mjXR9:$vs?v;몥'}ytZ+)4p*Ok9Y&]f/97:-SXv3G,nOq9C5vwn~k~ҸK H5r]GLY~t>%{PL+7\ՠ';.jSA`T_ؙ{U-ԲzAfmvfE}1ϡ|p{~&s!y1V3R9~~1sW|RIAG'E zG`/nf5=1#<0LiތfᎫno͐ȼ2z!=JJ[[Bcs"CTOd &nm6iaܥ!Z-gI;Ӭvs?HE毫S\fQtսh#jfIaay 6QkӳPWnzknqٶfj9;V T2+Uw6BzlU`^22c•(Ek SڐSxW M*+RyVQ3_)JN4ƫFBy!6Sym ъ 8+V'_2a]ԘYT++d h,3y p(Rb6+e|djbgfS/3wS}gV)SaםQ |+(c=w0WYtn$ThRKN5_f6j_Om4x[~e?K0lb6fvAxǧXU"WI,7}?M<-k@d?g**LpiRBsYY-$M#kc Ŕ7~6VJ6bkw\ m%G%3k~XP0 Gn 2٢ޤvA+ﭕ CwOSA-օj>J$k_ҸYS toYy7ϙ?Lʲ>*psˈ#{cȲŘ%(Wu29K>Lo͢.fJͬbTﳘ,DW4 kFB}[GRV#!%Rdoph@Mل? Fn7dR x| >#rd/L`+2Gmѽ\}m yGYGG$"+o'K;\7ΞKWs7&̜!۬:n̹13g^g0xx5aRHk'座- ͓(7fbHi.Fd&e8M .t%)ldM4=i->sev[:|(O25 l6.HxvuSC]>O}< 9f |S&0w^Ǵ*/ֆtz[[io4cAK3UD+ҙ^'4kIp9FIY^UY^ƦRO'fTz/:)1XUoʋփ(zOyTWg-5/eDƶNYFWߌJW;}3Y68~\Ox@~&g_JGCKm8z) O_'PHnNN꺬4剃 ULlaCG R)FCixrnwC)\3 c\H`3@~܄I;rKp* (Vl 'XIjèMqo6aa=0!|?PR?C-^ڎ&Fرfe߭#e!Hm$ [=uq5 챞ޘ5!6͛_lM"`-?l1"߉A @||ZV1@zgmۮ}_sNE^! MsxH;zbZ{5NCg;S~p(/ H>76oQз갍ն毊w0n4޳N÷gTz.5a=H$#NEǐlLfd4RBk|tctI/ZtmO[n[TZyڋP8wQج5͊Q''(rɦ CT mNo-$/HW*E׭㻄F~,؝ڇ CvJ_Bl{A1eG>L+7'pmaGlNRVe-g6A 1#m5yE.S=_ga?qd<-坄CrP$AQ Pv*(ۄ#z0bD"t>df0@:^fnLzܞzWS=8Uwճ>Ztn覣YM]_&5 endstream endobj 79 0 obj << /BBox [34.9209 38.6514 35.6572 36.2383] /Group 205 0 R /Filter [/FlateDecode] /Length 598 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HlUK0o͂ 0V1ꌝ䤝v=ޘ䝥Iw%~lo1<ozn}#I{Q%x)0lklh)-IcO7 NaD~?5o>q%_zfW9K}7i{ZZҜNi bf- Q"fߴLkM3NxRDkQJ*&kUO ʞ0_jpKVWuV3,vM MI~Eh1=[Z 5.R@\;oDt;Vf²);^/! {n(P`qN:xB;/l .JΩJ I.V/&W QʝgD6Cmy>qR@*h18iZa SzH & dh` r,s›bv=`2+ihq45siӼi KIkg_5^^cΒ<5pRvh=ߖQr.\r}ooiIvcIszXy) | 0FL endstream endobj 80 0 obj << /BBox [44.8276 41.7422 46.4331 36.4746] /Group 206 0 R /Filter [/FlateDecode] /Length 580 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HU֫z1qϳpco oקy~uY. ^gS:wч $d+Yj%!Mԓ޹x>yz2Ϝ/{/=OkmL 6xfT8a8$<_(Q,x۴#'h\Z*nR5IIL IEsԢ%]mvT ZW`muRM eU"ܰ2$ػwQWzI:/k"{^X0p-aSH)B5|،aeaf()ąAPc0s yyD̎ \U~H ]rLeA$:r4QM)aweE gզ:t+; 3NCJЃ54.r &ɝhdL1ƌ#"Ə طpOy҃.wj#Ǿޞ>1^&srD1Mo`K endstream endobj 81 0 obj << /BBox [44.625 39.082 45.6099 38.7617] /Group 207 0 R /Filter [/FlateDecode] /Length 140 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HA 1 E9ſd6z ]W o:</!YɌsȈw9@ 4NM05t"a ?^^\o;hKKq8P+KΆy>XhV+54PdM? 0"l endstream endobj 82 0 obj << /BBox [44.5991 39.334 45.5654 39.0439] /Group 208 0 R /Filter [/FlateDecode] /Length 136 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HMA @ nnvi=x"Z~ߤ ɐajȖX߃a{Ƙdt&NKo#nw<";ZRQA˘ c6 T\.ZAC 0b" endstream endobj 83 0 obj << /BBox [44.5615 39.5898 45.5029 39.335] /Group 209 0 R /Filter [/FlateDecode] /Length 139 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H$ 1 Dmݞ{xZEVX=G2d2$8M1X x2J#`j˕q;K?>Ɇ@' XVjv^f o"aS꒻BBNOӴ"- endstream endobj 84 0 obj << /BBox [44.7041 38.8682 45.6201 38.5625] /Group 210 0 R /Filter [/FlateDecode] /Length 134 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HA 1 E9?A'iiBF.\QAaƅ7-> /ColorSpace << /CS0 40 0 R >> >> >> stream H 1 yyli{AV> /ColorSpace << /CS0 40 0 R >> >> >> stream H$ 1 Dnڜ{xZEV2$ 0o TYm ˓:u*v&?d,zq3`߯/I`(q#K8&oYYXq[60R/ ! endstream endobj 87 0 obj << /BBox [44.7354 39.832 45.3975 39.6641] /Group 213 0 R /Filter [/FlateDecode] /Length 134 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H, @ yym dVAT2 CȗBpGR `uQ4`/jcمVOĎF:G\'}Ӫ%C$՝dq4^Q}`FgW !' endstream endobj 88 0 obj << /BBox [44.7925 40.0586 45.3169 39.9248] /Group 214 0 R /Filter [/FlateDecode] /Length 135 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H$ 0 Dw}}#2fB C)-B i~dC7mFS$ 38% >MCR!]D8~P|wp6%pģtBeX  Xٵ 0+!U endstream endobj 89 0 obj << /BBox [43.5596 37.9072 45.1777 37.2471] /Group 215 0 R /Filter [/FlateDecode] /Length 136 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H 1 DlvÂA<" 2dR3lj6A|h(UP* HX$,w0GR90X(c~>bJg. ! endstream endobj 90 0 obj << /BBox [43.5723 37.6162 45.1748 36.9473] /Group 216 0 R /Filter [/FlateDecode] /Length 136 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HNA 1+t{XIEV~t 3 dB2ώ &|r[!n@Ѡ㇌='gEq Տ$oq}Ip3SSq:c(&G/i!P endstream endobj 91 0 obj << /BBox [43.9082 37.3662 45.2754 36.8047] /Group 217 0 R /Filter [/FlateDecode] /Length 138 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H$ A <> /ColorSpace << /CS0 40 0 R >> >> >> stream H1 A E`6dBXP),jAPX-ȇJ"Ih2Up-s34y~z̸\7дǗV/A3 3P59jE :9 endstream endobj 93 0 obj << /BBox [44.8589 36.9062 45.4219 36.6621] /Group 219 0 R /Filter [/FlateDecode] /Length 134 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HNA 1 nҤAP> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H11 ާĞvֈ)$D퉓YtTɓ;dOjI aݎ&B8ΰzi:I`OX2>anч]r$hvY~.-\˴[%c'J朽mę&Wrk]61DjEE*W9v&|;K6P endstream endobj 95 0 obj << /BBox [36.4937 44.2432 37.5771 39.7949] /Group 222 0 R /Filter [/FlateDecode] /Length 174 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H,N1nAy0ewk-~Iu{i`4^):e8$bC׻v('1OX1HiYFS ;]TI V,U^[[+4P,@SջcKVy 0hs2 endstream endobj 96 0 obj << /BBox [41.0288 45.3447 42.5601 43.958] /Group 223 0 R /Filter [/FlateDecode] /Length 171 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H$; BA E"0&ϛ- jo`2p|XєrM p<]L[/ Ag紟;|P<4#Sw/( 71L\`dlelR^4+Qz5Fd7O&u%ϱ셺Yp 0f3X endstream endobj 97 0 obj << /BBox [36.9663 35.79 44.9111 32.1152] /Group 224 0 R /Filter [/FlateDecode] /Length 2334 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HlW˪e ?P-Yq B 2UBB t迏Bh^Dzÿۘeq/߮O;;/kdk[x?_!;G?ȗDXUeױj*s6IuZ6:69lbr*ߏ̀2)8"XQ˂~s&Ht~˂D0Xй)%}܂2HiD]w@X..ƃ 9 %!Y>z\H.]r+0,$ 4ҧ' M #0:k*ņp/HVFIB"|8kx ¼ηG,7VK. NJ@R }ɸg'$aXj(~U Ax/Cy sbr!-c12J/p72 ȡYW̠4ʥj}(3&x7(4Y@ w19ۚg 긟!kvy:TX\qXIy ٓy'/n3 Qb)pWY);&QߔrĂܩXvm] ӏqp*VO)t2QYu^]TDeywaFv醭YBLM<7Vb,DY DLٕ6H07d+4DݙƧ~8)q_U2eeIVYa#`B%Xx7^Fދ(0|:D˜']7EqZ¶G-_&] ne\ytnF~2#)| aqLı0[=wٝ_zl@dv$؛ͬd gjh[`08ݽ#u냄͌LkR}6 5 R@_Fĵh~("? &o#2g,^7Πd2̕,N0.zd18Ga '̑}ݰȼu<Áx,x/(d[!*-Iמm' mI m+ 8˄@fƀWfPRy~&7twl%-f#)BPʢSeƅ>neyc-VJĸ(֪)SE7Lhf,7Sj$O~r ǂ=cх/dHu؋153nۋ:060)邊(M%IE8dHMhlsr4`f害 WEJ7. ̏aR >PzN~XY^gْw)ˎDy#ʍށx/ Fľ`)썠oQ=@$XZlR.FCX 39=<-jAk'zqc ?AlW\M\U* VWO`4XZd^>|PAjE2r%Jl`Ngw֬yYeT)Mr(jc\hKT֜q 9H0kDT4WDg::;A՞SAN8H8+tf փq`{其tIxÚhK.#v.&h]w=eLk^(0Q,PSJk]1WNQV/dGZ^nE[O}Z=$ GZ>ɩ4P4{dcx~里e8! eO.JJvF^qUW<SACF"qB9z6BgdOYy4϶{=;)aÓXr$#B ޳X=G='5owpbbA>gNa1|5oQV֦-ڳݓKc)e8'F`{PǛ $ȑσax!`6TvBHnY*uNZ$',_k,o7|MKQ)j/~'*zG!Tf^9|dp,]=O(zmBszyDhV*5{0jOi$Χ #V] bqh ֳON'xShP֩"0A}vc{,Bá` Dݷ,zu}  -˒K9͚)hI6m0c"A>FwA\kx!甭$ OU endstream endobj 98 0 obj << /BBox [39.2222 44.2187 39.7939 43.3896] /Group 225 0 R /Filter [/FlateDecode] /Length 280 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HDQKNA)w 0QW> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream Hlѽ0 O $ ݌`gIH'o;? K3\PU =u]NAV ÷ >J=2|5$.F5scbؔtXԾ'KK"7Yߖع\!ڭ/9 C8j./7l{>p ,T(bk9xjpunbIޞITck/prx@ endstream endobj 100 0 obj << /BBox [39.9106 44.6621 40.3057 43.5967] /Group 227 0 R /Filter [/FlateDecode] /Length 233 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /Shading << /Sh0 186 0 R >> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream Hn1w ehR)K5p:~|DE7Lٮ'I5" S׌ 510j3[kstf=խfdjsKRk> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H\1n0 EwBIDAf I *ntEߡZ]%8n{`u'M"ڤf ;9L*{3˟JٹWA2z%#9&ÔHe<9">1DI%cl-u몍~_w iTICJĢ> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HTj1E{}~ ki4G wvhJ{>zF3krv /SkDn7't'H9LNͩܧmpnCGj7xyᎸa<1tcHE-Q"cen jfTA IK{sj3*uI wEϔ7Nthϸ6#YC,L\oNA֯8$k` W ھqjg ,6LX$ZacdHB1snHۼ*58 ah7v3l49VP Nz@7Cۂmykֿ?|4/?._|~Pxvtn?"fIMk&h=(>_4_s(_[_oK},w endstream endobj 103 0 obj << /BBox [38.6562 48.582 40.0278 45.7725] /Group 231 0 R /Filter [/FlateDecode] /Length 291 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /Shading << /Sh0 58 0 R >> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H\;n0 !JZdh K)`w?C?MRwYͤY?nɫK[bjJG?^`+UfUV/<Ԗ2 uYi3,6tC 1q8ٸT(5qFj>٩yzxnˉnLϝ_Ujmms̪s;nvPVb:sč3˔D B/n|>'Ox_gWB&`V3fFm ^pZ> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HT=n1 {BZDRl  vE\?3#W;ߎJnCr[Wʟ i]Ԅ@A=)Z[D#U'^bUe#1B{kg]]K" A$ڋѮ@JE *ə@mRvgk'E=Zdq\Wm G !Sn0 $5Ԏ#Ʈe^,/> /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H\=n0 Pş@9)@eѮN='n̩{8TBu(0?G7HhfL֮R_8G٢*!Cem$ḇY4ń6fXqn|d9F"]ǯ۱nX rܫm=_ ?@IH6(Psco՜R^4qq5Dg8ïXe endstream endobj 106 0 obj << /BBox [38.6904 46.7031 39.3838 44.2422] /Group 234 0 R /Filter [/FlateDecode] /Length 206 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H<;n!{N0SR(IeKɳVa{UWbV)t+o_LZ^{.pbس9f߰ox 0 C endstream endobj 107 0 obj << /BBox [39.7466 45.2793 39.9722 43.7695] /Group 235 0 R /Filter [/FlateDecode] /Length 170 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H4OA1| كg4Iu8e5$ Ю춐.Y }Ft<]IOM 0n, x)3Ӂq >[ T jXvkS+̮~Yl540 0H4 endstream endobj 129 0 obj << /BBox [148.123 480.928 157.843 475.888] /Group 241 0 R /Length 59 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream /CS0 cs 1 1 1 scn /GS0 gs 148.123 480.928 9.72 -5.04 re f endstream endobj 130 0 obj << /BBox [148.123 480.208 157.843 475.528] /Group 242 0 R /Length 71 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 35 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream /CS0 cs 0.137 0.123 0.126 scn /GS0 gs 148.123 480.208 9.72 -4.68 re f endstream endobj 134 0 obj << /BBox [147.59 474.856 158.39 473.056] /Group 245 0 R /Filter [/FlateDecode] /Length 76 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H*2413T017305S04гP0Tp<.}`bC0T(N ҋ:M,`:uZӸ  endstream endobj 135 0 obj << /BBox [147.59 474.496 158.39 469.816] /Group 246 0 R /Filter [/FlateDecode] /Length 91 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 35 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H*2413T01Գ04S04гP03P(J Ww6PH.V0346F`LA8(N/cngb 5FfNW @`] endstream endobj 139 0 obj << /BBox [148.274 414.555 157.994 409.515] /Group 249 0 R /Length 59 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream /CS0 cs 1 1 1 scn /GS0 gs 157.994 409.515 -9.72 5.04 re f endstream endobj 140 0 obj << /BBox [148.274 414.915 157.994 410.235] /Group 250 0 R /Length 71 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 35 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream /CS0 cs 0.137 0.123 0.126 scn /GS0 gs 157.994 410.235 -9.72 4.68 re f endstream endobj 144 0 obj << /BBox [147.727 417.387 158.527 415.587] /Group 253 0 R /Filter [/FlateDecode] /Length 78 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 34 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H*241372W01430W04гP0Tp<.}`bC0T(N ҋ M-L"M 0 endstream endobj 145 0 obj << /BBox [147.727 420.627 158.527 415.947] /Group 254 0 R /Filter [/FlateDecode] /Length 91 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 35 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H*241372W014ճ41W04гP03P(J Ww6PH.V0346F`LA8(N/243E2GŠ4@. endstream endobj 148 0 obj << /Name /X /Type /XObject /Width 206 /Filter [/DCTDecode] /Height 174 /Intent /RelativeColorimetric /Length 706 /Subtype /Image /ColorSpace /DeviceGray /BitsPerComponent 8 >> stream AdobedC""""##!!##!.333.!>BBBB>DDDDDDDDDDDDDDD "  3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw?I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I% endstream endobj 149 0 obj << /Name /X /Type /XObject /Width 104 /Filter [/DCTDecode] /Height 121 /Intent /RelativeColorimetric /Length 433 /Subtype /Image /ColorSpace /DeviceGray /BitsPerComponent 8 >> stream AdobedC""""##!!##!.333.!>BBBB>DDDDDDDDDDDDDDD yh"  3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw?I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I% endstream endobj 150 0 obj << /Name /X /Type /XObject /Width 129 /Filter [/DCTDecode] /Height 131 /Intent /RelativeColorimetric /Length 494 /Subtype /Image /ColorSpace /DeviceGray /BitsPerComponent 8 >> stream AdobedC""""##!!##!.333.!>BBBB>DDDDDDDDDDDDDDD "  3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw?I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$ endstream endobj 151 0 obj << /Name /X /Type /XObject /Width 107 /Filter [/DCTDecode] /Height 144 /Intent /RelativeColorimetric /Length 466 /Subtype /Image /ColorSpace /DeviceGray /BitsPerComponent 8 >> stream AdobedC""""##!!##!.333.!>BBBB>DDDDDDDDDDDDDDD k"  3!1AQa"q2B#$Rb34rC%Scs5&DTdE£t6UeuF'Vfv7GWgw?I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I$I% endstream endobj 152 0 obj << /Name /X /Type /XObject /Width 171 /Filter [/FlateDecode] /Height 95 /Intent /RelativeColorimetric /Length 1099 /Subtype /Image /ColorSpace /DeviceGray /DecodeParms [<< /Colors 1 /Columns 171 /BitsPerComponent 8 >>] /BitsPerComponent 8 >> stream HkLSgC) 6ʔy edN>/3^2ز,36"qAcaeh"(E.nέnA`LP7=Gj0@-ykcEds^4zu52&' >Z@G=ϭwrܪ~pz){3~S[h[ja־o)fHCU:t;?eIX=.U)w>c\ggQs3zj)P--*cSZ[ ˄M2 U܌M⨓(ݎM>(*MR 6ʺ)Pnl GՋM^!(nvm#cSAl D6l wǖ &L#ԭ0P%`j5bK,B}[2=@6P,l $l TEK׷VT ?,Ig8>gFlT5L/'H9q&ؗ8k|:gwnt ʚgOd?[kƐM9wM1Z Q'QįٸyM׮\ڢ/#r|W)*Ak3.&=}f̉]'kM[=czﯾ?~Ҩԫ~,6-)!jԥs;#Z7ov(ż]$N Ι;?fWDG͋ M, _ch4Fh * endstream endobj 157 0 obj << /N 3 /Filter [/FlateDecode] /Length 2574 >> stream HyTSwoɞc [5laQIBHADED2mtFOE.c}08׎8GNg9w߽'0 ֠Jb  2y.-;!KZ ^i"L0- @8(r;q7Ly&Qq4j|9 V)gB0iW8#8wթ8_٥ʨQQj@&A)/g>'Kt;\ ӥ$պFZUn(4T%)뫔0C&Zi8bxEB;Pӓ̹A om?W= x-[0}y)7ta>jT7@tܛ`q2ʀ&6ZLĄ?_yxg)˔zçLU*uSkSeO4?׸c. R ߁-25 S>ӣVd`rn~Y&+`;A4 A9=-tl`;~p Gp| [`L`< "A YA+Cb(R,*T2B- ꇆnQt}MA0alSx k&^>0|>_',G!"F$H:R!zFQd?r 9\A&G rQ hE]a4zBgE#H *B=0HIpp0MxJ$D1D, VĭKĻYdE"EI2EBGt4MzNr!YK ?%_&#(0J:EAiQ(()ӔWT6U@P+!~mD eԴ!hӦh/']B/ҏӿ?a0nhF!X8܌kc&5S6lIa2cKMA!E#ƒdV(kel }}Cq9 N')].uJr  wG xR^[oƜchg`>b$*~ :Eb~,m,-ݖ,Y¬*6X[ݱF=3뭷Y~dó ti zf6~`{v.Ng#{}}jc1X6fm;'_9 r:8q:˜O:ϸ8uJqnv=MmR 4 n3ܣkGݯz=[==<=GTB(/S,]6*-W:#7*e^YDY}UjAyT`#D="b{ų+ʯ:!kJ4Gmt}uC%K7YVfFY .=b?SƕƩȺy چ k5%4m7lqlioZlG+Zz͹mzy]?uuw|"űNwW&e֥ﺱ*|j5kyݭǯg^ykEklD_p߶7Dmo꿻1ml{Mś nLl<9O[$h՛BdҞ@iءG&vVǥ8nRĩ7u\ЭD-u`ֲK³8%yhYѹJº;.! zpg_XQKFAǿ=ȼ:ɹ8ʷ6˶5̵5͵6ζ7ϸ9к<Ѿ?DINU\dlvۀ܊ݖޢ)߯6DScs 2F[p(@Xr4Pm8Ww)Km endstream endobj 159 0 obj << /Length 732 >> stream Ŀþ½~~}~}~|}{|z{~xz}xz|wy|vx{vwztvytvxstxrswqrvqrtpqsoprnormnqmnplmoklnjknijmijlhikghjfgiefhdegcdfbceabdaac`ac_`b__a^_`]^_\]_Z\^ZZ]YY\XXZWWYVWYUVXTUWSTVSSURRTQQSPPROOQNNPMMOLMOLLNKKMJJLJJKHHJGGJFFHFFGEDFDCEBBDAAB?>A>=@=<><;<;9;:8:8787676465354233122/11.//-..,--*,,)*+()*'()%&($%&#$%"#$ !# endstream endobj 161 0 obj << /Filter [/FlateDecode] /Length 48124 >> stream HWˮ\W#8@6""``Nj+VTU79sJBBH6}/߅|o}:sߔǧO??]~>/%K{l|3̆˥%ZQﰟۺ:28{o`: Qﰝ)?,.gF 3ZK}_/?n-tOdT)q0;up[s sr.9k:lu>'{\ߥ:5zSsG\5(cC!:9LQ8}+v 6f !_&݌f+lNMMᑆ8KGF EuŶ 7.Qsӊ)$E[+ "T4; aX I&ÚaS` ]db{j&>Ys>s™Ӛglgϖ9 [ho#E|[ P|hGLДPh@T;NJ:4ʂ 栴'UC?d64Es:(V#C:FY Nț3"yk)"*eaHqOIUaB0+nN?jNy8"t7# 7)6XjL=XPq]QQj'=5,HTfK >. (s2$ܳ lB;91Yu݃#X9CC@O)C05 t%yxfnkU0=퇯MZZS "rXi d;}6sNC: ʞ7l[2I~BuOCè `u:c;{ńu^ +"[.dݍa# P f1꿂%*))Kؓ@He / &R>Pa2g@#(8PBҼl gQn,Տ޴f7v, _YSmiO@qHk!ds.d<-rTL>l᎜|r'+JZ0no!F[C`<#H3XC~PUK{,{sŊPXNF"p$6B|t>BUFǧA!7 %iBg̲gQ "*,G37(/n:Ju@?9Tj.0X⽃:m| a=w0><ǘ(*^fcg>/g>M##+<\G ᕐᛠLcӷ |Z nS?^\SsO!g5`%~[cg̞] G,E3^`['I;,{H1q3ma҇!^]4xKk{2GJ@-J*^fѤ~]՝+ bKQVf(X6t./AW|\+ &T.Eˣ.d`H{֊6[7#wIE`W-qKrr>uDL:bџ*H̒Qv|ZK]~UA$cWƢm\voò`gZC} ߏ\b<+ Vfz剖z-^(aҫHeb wTߵz~tB֠2a۷ iUV̫>^mmA;ȷˮwI(jk(i*G8xdQ}H#i#iɌ}V=ZDHJ&ֆ,P`HD$kϭ=L`m:!:"ΰmk~ٙDMϞY9'HP>~ȑb>Dl{xѡ<"0Aƌs sWg#c3ІpkhȳdH9oiKnSYg#*a鎖{`$8'n6H2fXu`OdDMtׇ}77<ȇWR ̀̔T^dR5 uecuqxhUh\F2WOީdi\* 3حӓJsA{K@@4a"Y!EC9S-O@1E蹉/H*Rpv .x#Ȼ1JaЇ? %qaPљEBֳe Emd뫜9y~tIff ŕWOb;XHv lA M]n*bׄC@*E?YeI RQ-Hƺbr5_]*o4M|\oTFxYV$qQ,/~Glf{;% 鞓Ql,^G.}J>yIAAAE0·*؇mM .z7XFU22CN)dm}ESi].Wqj+L]I:4u%~%PfLM%:a D^/e(Pپ斓}ѽҸC=aFUeI=b/ƹCS/q] ;K9xuƲ}!n7^/ jLcFH \Ru̳q-׷G~yWy*O/%6\ˬyXj%$) <Ԯ<=c~j`N*n`|_O=8sxXԨ= w/4ѡ 8#ť]PB< E)4o%wQ7/"F?}rS8Q: S/ԴTeM ߷tPXp#|\{fչ21\GS9tLP¼ÕwՈ< >zTn\) s`#zBߎko )f+J漾dz*GFʙ[T746GTr5F'jkRVj^lCww~8NWm!mQQ6c3#5YP *8 NRH%=>sr,&[WòjU1tSq,K [ o+  ':ށCM~`$$(.!*N_%IE~Ŕ!; ^B^ f%aƒøLVO n!}jeOi,H%HC$VBљl}pB Gi@S7iPӷO%OT*ļ%}yk0W@97=]`*: Q LlNPs3Mnd"N:Do):+A.C7Qb@,=HZ0]У1sR jf0W* ) (#4Gl@+\D0k($~d"\kE7r]_Cwʠ6LP-$œ^ >1Y tΖچw}`` _Z]X5KWouK/-l"X_L)h$ywȍ`]mr5ҕM"6lGc?+8Cdk)ɰ9> [~ L95&Ԟ* $ C;!Q$#|FX1*3u;vvpIlRwGT8R`5i>&? IN ~tsA+jDimm൒}['iXR+r侄?_Ca{{ e>ˋAww/':zoCOloSpY[ϗfh?sROzZ=J:RKB j`XQliQ#}a)eRo2椻 P3{Rr c-=?ٯv,vUn?cG?0[ >L #ՕD @NV$|"JX2HWސM wr]WS2~ّdu8%d.UE+F$){zuP YS] %)8$&zJkx'+|tN;i%1^1qH́s% zqN 's΢msUm8G&8u6iS^~0** Ԉ]oHRs7y쀕y8hYNjYRhr'S]tɧ&Z$[R6KɋU؟gx0ԱPڷ}fLS%| J2I@|]2%ZUNx&{)Bx ņxRXwd >WC8D#7tX1WmE-}쟼/ʫ ՙ>+v1D<ڛޢݤ,ʗ#dUxZTk)ƅ(a2iZ+ +gX*~)Im1VmnӲ-EP+͛)wpntNaF qd`]݊;3Z-',/m;}>np7zB]eI-IK-f$hsr.{!J]RmRfB%$|DfCM!J\%zЋpK˂u%б3fne Z%c4郅 XQfpLU*u_*i*AV[PBY K2h9 vgnQQ@dhkg>ܲM05FYl2UأPgt 7Es+;yh%17Bu#ȹϬ B8- BKY'qo)ۙj%GuJ6#]8=IU$Xl6,Cx70!o0 < SA_azE2L~۪Bf sO;̞}Mj3gt\k}Eui\dsTHX5`T^`zH<2HRk.e'" 0\YnݣUS;5$_C [ٸp֧c<+{HƿiXA3xwe)+6Go|c{z{~ef-i>zC gє<1uQ6H. l+iAK4:;ZzAT4)!+HÚf٣/&Lm\O6UIۨĀb|<;f¡w4v ;^BHcz{zuIpJ+D"nzT4O U-IJF|XeȅɌ1rgMN\~<($tH1v8v9#>c@kU<~G)?HWy`¬I:͎R?H7?,yHHI o%N^jOs ؕ+!=+ұtrBG2e^m1K+#i{Q&w[M ۍJuWƿJatXvYYu`@axcLD1LՎ`c*Lch@ݖ; IB3Pmjȍڪ҆L_c,~V ā]A<#z "'޼{ӳ`Xt9M٬TN^{ _Ube{_!=|jK..P$2@:2jX9[ĚrsnYۍKZZٗ- JsOH'/aL r^@D.X*x6 *&ɼ +TO;Gt]u!K|-7}^8E7^4}뾋GtڗxOJ҅B㹻!֍ mbT|>m=TSfLCIh$1 's΢maʌ=]p .] iS^~0**Ko*|[&tMN|keR<>  % ԩUk(P Mk*av`-K Ip"-)L*!ǙU k<XbKuHs:XRcP.z5-zYgW9$@6>3 AWGfU7K`%1LXgVnm$ZUM _ B; c K2TZ^ Ų'2^TШi,>kmjJ_͂!uESW$KN61D<)у/;ĵ13 ۢspPKmp?(gNH+" UEXZX~^~L* ߦ׶AU^)w"qSnVParwk6/xv.Kjh'4. Ou.ٲ딖,%Odisv/{aʴ]rmrfBed ÆLmg3J>NNYaaᖙ=?C'UZPz@}+Lh" ? ?%E6r3X7Ri9dxsiO N= ._-zᄁw &FfY)pEqMLih=PtD!y/Q3&͜]w"F'ƙ\T3YG)Tg&3)`׎PqKIgPُ"'qo@[iST_?<.xX H/x4f$cjt·WM1I[AݮαDZUdQfhU\[%yx2k_jS;zCODƘsGn*ÐX} F==nlӹwsx<"ncarX'ęWѩ f<+ jo:=X:w5b:q3-9 nO=HlˁZ#2=au"H"_-sf=l%=V 1!(yN2Dڠq{|vq=:0I'Rdb`N;PEγ=8Rؽ:\&yσO@^EcځW05+x1 ~A%NGg2?;[SwʷImӳMR/ *JyȾOI^ F$a/њ1ę ~U]{_a⑋DXV.thKe3$f0.3=iǯPߟՌyZh)#׃8g3@ׅ:Q0Ho`J߰Ǹ3oL/r`̢#vtH &%#rz*^Rd;THn>ޯNqܵsQ }-qV w[([/m]Dklӳ}|W.Eic1bi׍6Iʃ1#@C lnWjQ/H6+\3s8tsc(@BAP1л65^af5AzƠ)EH!Ԅwct"bzDْs :Zyvs8s)<%KIWQgVW.q(}J LX"M21kTWv'ج'#~2)1Q'hfhSw!Z죚Tm49N0eTfkP @$mo m5Mz@AC&sUGwL(fBq*?_]wˬYU-cL&!ؗMoŴ~X'!F)jfNo&f ;iWgn7ո[}9 wk(|KS]Hkvrt<u~ T)t l'Heu"rcytgtF:9و|MPQq+f42q&{11NjZycc>gV^ Tpѫ*FK~ôOUnDbn✮IHyf,[A7QKq' zPҫ aϏ[ Ќ$6^ nF~lD׵G:856m!WioW,|jД@PmpBtDch5YΖjPM?54(IVA@Wavnw_eِu€tM*A 1uYˮ"<0B5N(6X<^AEQloJceHi,>kFOAqZ<Gڂ$,N0BYJiR_J[P) 5p/'U(r,|]R5Kn]uԻKzwIﮣ8RXxk$yC_)1|Ŏܧ8bco"cX{2+ۛcl1'snP_"u崍t]u={ȉ2娏' OZ7U\Ǖ:/@Ǜ(BNgVnnr;h.SϷV(}`N]ȟy%KM*9,j NC/cNy&}A5;hP0@Ԗ[^ky4OWYYw!1[fpth[Q;1k?ϵ7? _~- ׮*ۢzn:Y!爃H]p2)ICR8y,]'Q"?r M#OQaiF:(i"QO^pRkMyyh%اq1ZO-@0J"* Pܥ*L4FN=Ǖlh{cSunOǓⓛpSj=j:^Oo/k[r44dž["a" .g׳(W@63 &k:A+L'P`0`UT^6O [9"-z0TђwsUwW>Z#kqeS@*%s}`<ўԮEmFz戝5:]QڪF<<7#۵?Ԙec:]!(sN`Ț`ՙSkꯠ8pJurJ9aJlE[ޣ薤=F Z=WwXց#aV0)s+i?=L̫iq>wӰmL_-R>kt>kXErJΜRʹpX|~ UXVjeG(8d*pGoƬ<jYxC0Z"ۢ)nA܌,}1=#"-Ir+-8=Hse =#ZȔR爆'xQOX2yIY𸒜+}MCAW4K2qL jA0x{TxiG3n.x`.⥵x,HXr兵(7ko"k-nb|YYY̏8x+޵|Vr?03 J @ٯP$q( ʙ#W)p[~Ye[5mnIM/>졖hm;L{ɨqN) !x(I;Nw]A‰#.GI*;7ձ-G)Rd9hk^y aDYĚo+o!MLs۷BĨCl8BlQLʎϹMVKPo8H}Z3!֮Xi![Ãhد9r$xWJྼG>[̬4 JZEܜW7FNxRY6sVcYܭ>&SF ^qV}@𑹓 95r\k>yrYe#7tR>x4$JŎ]Z(e+TQJ6J+)HS0e\oz;~u/\nP]ʺqaSfܨ[ E/')JSh"HzcHY\;ߧ "0`V¸Δ*vk8za o|/> :lKӬIkٜ9Qe=)ZQ$^Z;Pj*֣$;S7q%J=ǯS΃k,N; %˜U7/upt2~!uuitQPHf=ErXAI!œA#JfmGa[& Vxl!xrG4ơܟ5(ZSi8KfG a;XXdIud\l1exˎ@ssv~f*MG DϤXih>hyI?gUMI jMF5X ߳٬=_=`^(N-p1JΞ3oq1}qw(qۻcNMx3M42ώh/~1eW"D.iIlPVOcP[E9bMA_u Q 62_QQ i~U@_P$0ŌBmqgh't:or0O\ }P|f ]_?.bٖ>)U}փ3$UHj X&/skF2Ȣ\;vkmxɝ_~iw;bѿT[Ñ<Ş؊V]r%Le=Y#r\LyNk4wV=ņMϚje=5]C'-";&'4@gv4eTk8 Ā2`^xO)ٚ~E;B_:y{/JYSU6Jn˝HzW4TbnJ"ڿ (2ă֗5e91 h`D~ԣa I}!,9-;JU! ˥=="y=/:uZS-q=:i.$t Lk4'bpA8j]QG笠Ou}??g>" !r*sv` n#cE LSlFy -|_PvTYTBjtJk-5GV)j]B%M6Y/Y~20q:mZSsJbOKtTbB+@ektoui(dƶmX7* STIJlrɶIfW qfF)J],DneާHeQ.@4j433K:!s$I]╋EJ9#dzdQF W)j&vYO6=nCU `v7ALrd3t doJzX s?= \oj1Xm<#x~hd%`zJi.8S9n4[plq &Q(_?#l3+HBu0G.i_f dZH&9LzڈG*i^K$&Y] ,u+q],`]|hYUVƪFvWϥPNN uD|+i/➃ScjbG vl{}ubEgS42Vpa ): \hRtqX.grx:v[qa6c T[׷,Z<֐\ւmxy2Aѱ`ξ}^嬀m8uYR =e)}BF0*FCuxWT/ouG $2jb& h@AQk+:`,`,"ǷJ^#iCؖӃ6fTpAЎw>!{a$HcZly+IA%$@HÚr(J$c]IYo\ txݍJĪ'vY4DjM{&n Z3+S'yT5PcZH)s7SYhX{O JgFLP1CQ`Y;:{cT]eޜhB,+J$1vdclrنQmq1AʹBwkΥ#n>ҏKQ=t PIŎlg((KYmTe01ޔewLǾGMC(hZꈥT94Y^NSX:FzAk6UbC`MNxUhcOݦ?ոj- uXv޾ᷴ&hXtntH~pw+)eߠ6$0ى $t70d}"V[NNS!:Iz`,`O+6PA'|uB(("EzPOBTո lF$-@NvX*\[z,IS`]Jҋ zGg2.7K}0.vN)Oˌ, 9>{ˉa7nEч8p>I XKnc889[ C FvIN`qCq(XDeчNO39<3:s h ]M749L{{RIaڤP̗lF+H'WLw|P4ytUZ%1#)Dž< ؾGQN|u:-+&Y}=\09U=Jb&">fٞ"9M'@:yZPZ)S5M0G{U$ɑ@M9.a̪nIc(/U_$46KTAnOFVC'(oW{<-E SS_H>r}wffneZ!+ۅQ.k 83A KϚcF>Xsj:F2޾Vcū!2?U\/k>(aW)z Ie d.3w"3MLz Lzaĥ ӛ43EN |AhM8&> :OQ}pS;~/>L/ N0꟝oܻƨ WKB aoW}&%im-D~H ;5w6Ej 39e4Ϭt-TzjcD U)k"vlV$ƒLH&@r6DV<eb.Scl1-eRv 8 SԊN6t8Me]1jdꓵZݙ뇗e>Ih?.ˎ & uhP;[WAD$'pk׼dw!N2?J.H8.7CZaY~ΛʪW0AV՞x3y~'.kNVsΩ2S'D2 {T!ݤiJSnZ8 [`^aX!ld{ s]qj Kڌ3 A)!(WNw*OSz'2ūybeY֜!=wi@`[2őq҄c]FZ9843 YhLR$i|f"$ r] t2ikv{ gР9ҠP$)8ݑS@%Rֳ¬BJn#3[woښv#!',y2t+jOr.Jdt)vxzpM!)?Ad DY O3{<[2i[5۝G9M[!Wk.Leʹgy]=SYYf9j]jsLm2Sҗ(aa[L틑@T+tki1],:`G;n Pf1JjӠ7t0ֳv0wyo*_Z7G iÙL\Uf#Yy\op%z򋺑Pk&}AE;hP1eAԗ5C8xr7eޅLm0ݘѩ \miGO4ǬkoE} +S½+܆ :Y!gHbC)$nOx,'Q#MJ5VU5 O6G Hz fq y.ˡgGl_W/A@e;Q'Kn%Lϸ}mg VΙ 1T~@Q5N'DH?DRf|vU^.= FMN}HWH]-&|Cߦmpnq*k8T Sy]M3Fb]FHɵY"GDޮ>MklMnfr4^GӺ5_pkA.ZHeJ#q^Yp'Sfs\#35-TTqJzFpm^>CHu=Ԏ* \4>(41~wRw[^J jU ʠ|2LVFc`N̐pzԫrDԜ8=jx"޹J֥LLj1u rb$ V|uν]v~%&2NHʼn* Q'u=UEÆJ.0Y/*l~BXӤ9KXJ:b9$jȲ"v%m#$yqEhP2\zK"7 0nm :MR"p#I 8I zёIj$%G72ݜQC^=^=Qt{v@Ur6|^3y]!KZlkڸ00K k7E23"_CqB_hd7ѭiUˇ%޳DNvoƖǘ!֫ע=0SH >2_iI8I)lCjRK,0ݒV pBIl~Z쒑6`"?6B9"cWt9Q IlK?$KxjB8qbBT`1q3bD :A2ԤlaEl|5| n7#M'ՐJpGaπ{9m<;q'Jn<چ<,U>{|w)#UDz\rY5I^ah譝h1v"gcri#6RFɴ9@Ȧ Mo%r2mNi"3 BIC>I:gRdd"6g 96f~LS)4;9HL賎P>% tb(CnY${&)͑2 LuҝԹԈ׌,/>PoV;$e_ 61vxNńD^Cu52שdhNzJWp+5x0)u $m8\UTw kqfԦ f*(A)*)PUti vbV9P_DWj؃519wxz xso  '777tanp6S a|#Ԧ8E"4*E#)fOK 4u[jk@!JB=/"|=M-i$9vVLا¾ v+M&KZ ͿHmHH7sM#ǥNN'Ý>p0 & 7d6.RNK֦_, ‘AnNmZ$4u^Mbлrd{ᝀRҐ^rB#6+9 hĕ95A)# Q05Y%7n)>7;5c[+ԙБ|AW$MR֊<0#y:Gzö+iG4{@|e" ^6)L7)wB!=4ӬG"Dr6͆gΊ*b gɡD!r](iVhM-!'7eJTz.< _r*V@nsm9Q.iY)7ꎷ%/x[DG|q ٢R=օ&Ȟ)%:X:Ee 0Sm͸: ;ihdΝcH !nAtX0p 86_1(~Hz_O" A@Ayh XpTm ) t]h]?@Kq7'~4ŴU;~P4JVV-mJsԀG-t)lz"lsٮ] ]U;;0bP<pbމ[z S8t`k9}?ێzˏv1 })b.g9[1TLʔ{nuV19`fgfrh3wVҶUpxK;vhqoxmש|4wsש6Cs#-ʏ,2]i*{M«XPt,ou~&RFTmysC M8{ֱ P@|Jw'(_Wiנ7liK`5=R7m[<tbla/H@Gr#}ۦ*|`r(u<ă}YGN Y)MQM/*5{-޲rWkUˡL65dFZ{qseq&'{[%o1b->G 4g; m+~4 2=BO~(弙l|#[;0MLެͤ5Y OVc~ B1{5'FE!j-|R-9bElka}[/žvau=EWgkuT,ݯ ߰MXBUhV9:qq^<>FmiisTlTQ򲬄ԥAW k*Hb54b` /y+"+p/+(ZQL*h G(.iÌͷR'$G-_yZA:u ۊżOD SUtJ ׮6{j'{_OhSk2e9C]x(gPܻ#d~5M{jWfu< oY/Y%w2S<ڴ6RVyz i'ӖA003ʣBחd,(lI" FK3ٶQha V%7I52{h6?LGYU ȋge&X<܋U& 0MĖ)Ej0b 's}S%c\t\R0-$g_ NYJi"%3)SIhg"Onqx$uZ)nA%{#Mo>sgD&Q[yQSWcԵ9E.jp[:n>И:5ؗ9sKa$>ePO6͎2Ak;N۴5u[n%$u^%W1x^Ri+@|w濞￑of& ĤϹwT[g GJʦU XTi B$\!d QisgڬO6I/*A(Qf5$2?R'^]^*sUZ?W~ ?e.+T lfXiq4J3(AyknFooRo*rlest{\oݯ u˻f\ޗjRŵ5HwYN;9M6Zeuͣ0R@&$d7@9I)rJo'W(b=RޱC}%6Vv<8U䢏J2&E;Fe1b#DY6ׂ*Pl է)WPD޻߁mS$y-s7y*oy{!pb{3n2-* d-MȯW WԿSǾey9re )a /z ?$_өBomJ-b0ڐLeh:P!bVӥu&.] ,g0ؖJP;J *r( R(F|Pu=--ZIg Sа$!?xA'?G`kq2oo?8ʇ# [HI7 XA ߨZt[o/)N7+(/!'4Yp5gs$z6>A"Ӌ1:M n&F窭]z> Zx2DznN6=UP{2%4q9sos~2vXko8/z܂a\m-b,*"&#[I$ցtRLK$U*Qmon?g^xSX3& A we*0lҩPW: ɈƤ;9Gj|Rl,|g;OUPI҇-a0m5]i=tTlphsK.e(U F[fi-2HXC' o(.2oA9 W'!`EkPˮcN,R0 L|nXچ/9< 섡@hˋ<&Qse`M_-iZvK~GpXYUͶ&2+s6t)8c@xp]S~Ѡ"f-\L:"EQHԮT_pɐ)L j{/H 8 :u]As땮 '&$ٳO/|4D#=!AV0F- am,B7_ɬIwjPXPRDKx/KS܆Q7;N$)O@~+]@5Dä @KSIv5ՠt0Y ʐz)6;=D(HI:xDC&'/ Ҭ^GIգii(eoA!͘kЗTD2I$y;2~uPI/n oQ)YjwuoKF&HCiswHHqٵb,j翢iĦCD l=, Ñ5xmC&z/d\Ɨr4Orܧ쿑vx~ܲ7w-Z HJ/Pp.Kp0TgɼV~æqfЂ^+4Yo*墹Dl_M$Oo)g khvQ<Hd֩MF! G3gk.w8SWg֡eiH54/r7?}l7:s^,]ay@iEbwjZSk~OadˠG?AfBlZ ;gV;w_"neNyzRjMX k#'RM墏Jf>m XĖ@I5cQkɂ* ѻ4+8EMܬp>$F\H %-s7LLq1y{!{C#ȲD9,lo)[ X:,YHQ%eO.智sȟ/v3 f=/OشؤIg~.dFv_ \ -QŶ*՗L N/!'C6wtɳ9xus c,0UZ}!-?WtJaC5k[..&.U-xh4 x? jj{ڄڞt A"E*B/yB]}C*0CT3¡۸!>hiQ?Lh݃Lt]%UNfOyGeIjJπ+=zKEPn\PyG36H_4._FR紸ğg>Y~kOHxCd -!D6z~` J/'#[|㐪ih,,!jIcw@MyТFfE˼V{E"O *5M6 u@ ecصd-TМfkܚٶo5ɹ1_5c)也5".<7ۗ|ޗܠ)_ڗO,/RA@ɧsL}}R>5zA9 ߬WsΛ]OER/PJ}_O)2ΗGb\r.4QBglc<%QŁF^cZ%0=RU5֟Z[üV?FvKCW1J߼wUtH=/I$sBo߸CGwk>{gELs s ( S7eە+ ~^]:G!gytF;Yn.] 'j ʆ]VՆZUQ9dODYIUVlvmiMEOSԉj:-L(qςjyIc#F4i:uBɦbM>ߢeBɨ6xAqFHEZѢ=:ck+A3f!hcۯ?˕3,I( :4݇lcn$лJ/lAe'S+(6_.WE\4"bȦHȮeB+|ioJzCz-vZ"x5c}it} 2Xd6pB k>bXi<·r{^g]GݿδgFbl#JF0=>A74X){mu=َ+_EӀFX۫_˰#}ّAZW5&Ths9MPz=; w\PGl"xbxܾth,o(qpKl4T!8rHgg/u TMzv|n=rdu%h-J݁ѩ%1XƁnºDk1= Fą>6źq.u׌3]ʚ+>RO;MFs]Vad kFr4Fʗ$ KX$kH*ƶi#Mb؞C\]yxo ni'eů`$$TySk Nwaq)N3k!q#t;Oꅬ}8''ڛlq`Lt|MUm\$H,&?8~1x%FQ2 ؓI#ܣR=2Q 0-R{^5N||Yƒj򲃑"CWe0rVVh dlBj˄rH-}Vk?s xsc ;U7.$PQ&Rxi@uaxCrxŘQ9l8o:+ PZG5xsy;+j, t 06ʴ]gv o MϥL%<ϟ:f;pcбѐ/kd7ؘ|0M޽DVv`ځljJHfs|;L^r}Fڇ7K)Zz51Fq^z},Gh{:WP5P5qZ';:G5J6[$Yן.GlBUY Sf/:%dl}xzpr<ot#^*fG䙪$V(5>c?CQ~ ~9i/hV ,ә ˻Vf{;Պz}z~zNGvdGIN/0Z -2YOz ~Ug3@SʒP^r{-/BrF,էշ+ŵF4N`#LZ6hdgBͧ]"\0JJ.3 N9ȧB2Y#!⚄n.'F<^ScNok=Ȓ4ytν|99o: ozN$%&Rz`Y!o<i}Fȋ\DaZd- BXg-O446 h0I5=KkIWIn$9+(w=B栺fΈLIh50Dꋹ9$] 3 FBH9Tu(/xYfkbv%AHO^Iˮ#%xt (UR@:K.JNlBs*㑝WgDoX5€ibɸInc\8/7wm!٤aRU9o*ځ_hXePTŎ@ M#4/D!Dsn)b xۋy93;/tOxvZTcW|ʽd+DY (yN O2!Ə_ ԱN:>26߆2Pm@!gjaTdXݡ3gB"DOnX3 lYhwy&s>H>mP#T*ɍ%1\[#3v,ʉbx2SWWUYhY,u ˜Z%,3I) [ 4c&jC2PcBV( %I];@k-ߍfm0=(I~=#.Hs'i',aA,O#QAύͽ 's=zffսw~N>^f4}hdZ P81/xئY7:BV1wH׍Ũ@ R8h uáSZ^0F*œQºj:A$!XS wX^qu}S/jr)qTR! Nf{#MM!1S|U4Bʿ\ k1N{ 9.mKov ߿º3pş,ђ8H=wt}p>~8]\Z 4}Og@!ޠz sC4}1Mۢf\X?Rmdj'j4B'DEb#8Iy"wx9'븻u@p?kb2~ǒǍ#_vw scZ]޵v}s3aD.JJLZ W}YR-=7O:"i,HZF Ԇ%Fn#Y'iI^yos؛mhVc3tAuG4y^}Davfkt>}Ab|Ch.QjJmYΝ8ͨƱRYOi%e}q?Wsb^Ke=e,jQ׮;қU ֱ,|\?AK2.HɔVȢg,M@/u,u{Lْ կ/2Zĵ -iFB,;`7)E3Μ0G`Zv/?fmw}eLw&S!*U*=Ę6=DU)>u|pKQٯ8$x+"b=u#3P]HX|177JX ͛u鍄ӗ=m >:cpG,5SH% /X˽KJFT bg߮ }uNLsi @6~'sވꁑ$`W "^,ܾY .-?<4%jQuU ͊)Y9hQ )X1;̭gߦP:Bu ՏJ~xr\溸`NTr8o_-'{t_H=ؑxtOґ|OyĔP{h%[Lavwm/\+M_jsGyS)~Ljז:WŲMʓlt'.)8<pb]ϫ4`\n& |ګj_&u 8Y3=^\jrE@Wj| 0(p(nx{臎8݆![%ʌ.N-9gz,vӵm~oТm#{8} d9ú1B/_6kw̠K8båLF%/_ӄpxG$-|$|}â=]j Ŋ l-n*L֔}8yJ|Q@V4oLOe%SzcFH&+\_]^pq9k\T,+P'[9"C i;4Pn:/lXrΙfUghZߍbdzC.`Q!v물N}<#įl"h`8#bl~(N" Agx@8JoTz_\ GWyY ME. ٸ2w4;$?&& Z;eM8A{K:/t(D v. *F re$^gg} vt{[fr mw9~_9!D*tA䁢>ru/Sg^ 8q4n/{3,-u,ԑT1B|*GPjPr_-?e}]ׯL)[JAY~9q0 bI~dx<2ሥTte k)Ÿ>?seÛ:Ӎ~fI@QtC1 Re\t@zHEsgpb]ϫx+q~q> h{qכ٦NLFj.E3+SYiRM &-\_V.fsR.6f,8lt&w22ɯ=scoi:[GPTf  )sIO9M7@ N1dX >t"fB&/At^14rNE`Zԕ#sZ &iCĐ H~(fd5-"[HsM&XK ~j[Ack,!{d ]|z4O|u͠e*k3Lb'Dd 7Fӛ)]C%¦5$d9nZ ByʼncE"s{ͮbLVmH\%!;S֋M,}:@z}F7B<\{w+HݍKyCcg3k 8A1Tȷz;YvϷn]n{k){sq6jk|=;/W;+ߌѨ+_ydd=|rɮz̛vΛWHȓo׬:yݼIϮdrȽys=#P1 XPIH5ԑy@/RPFB *vؘ薑[-ڋ!c]Xy٣W^LŌ ܯ'R[\6cOT M#8-6X~1^h. F汒/֡?&}# 2lۃ 6sןK nj[p^倓"?~"?+ֿF[9Mw=ּJ<3,b >h=&Aıpjk$:qQ/sH.K%&Smd6j uXXnƗ֘ؓ2ȊZ7T1z~bObmr:%ʙr[ yI!_%Iv}^?<ϋU{3_LȤX]vx1^5%Qd~$Za>{Б{<>xdvRҬR<|eb{ p4w{:{=j}jKaingnKΒ a=* ݃2siO .:Ѵb.LN!'kIBbO׉^z *v4S׮ʀ$ӴK>9T UXek1 ^2p*\~<ƙ%y[~`WHI2M ިf\_= n_޳*f3Nf"籺,-iC7"e݃ܚXL^fHƴ)L{걝 =IFHTX*{wLĿk`,.!BS|ZǷ{jI+_seY˘^ۏj Ģi'g"*x+#ɔ=_jk.-͝Qq)BƚcCώܷ8phҺkl `k-ͯ"wݑs䦩B.q|7pjKC Ә|s%#} *c=[SU:5OB'o{oiN~jCŅء؏8|V X|<^/ƫWix*}9^mU Ut Wϳ՗4Z䲶oVv|Gq23Ɠ6_zef3 5_Xt]s!qp)m.-%%qv$U bIh1fZPV⫂c!ZxNj.ΆVߡNIY*]uبePoWw_7҆q?i-u@ l%8gKVyv/ioPbMQOWh r Ukr.;6lTC%>,N1F!R#,B Urn)?' ;'rjē5:;}⚘֫sh|MF{e`j*=Zfȕ>!cvj="m'ßwW_"uCQQNQLAc{ A~]qó|Mձ|="Uҽf>}Fqbn3 Y?wcmDU16:)40wR  oڦ057y' NY@F׀^֒AaEa8lTZ vA_08N%`];uiMs՚zdk(2aVc m̭v/pƯ3wʥ5ynVEoK涉=Mv_ka7 lrfpGY?$*nAOtVU5Yw lZ OTpks ݢfJ%RRE9'ՙH:]Ϋ0gUs(IP.VHW*?jCTY)ڵ b9v|4[PG f2b零/ϩ! jEmYb)??Wlѫه:'bOVK,u6/tx;GX+ukN!KN>G +v؟?:Py{aYFTxR(}^K4+0xUNc}c {lu=dEk&TBcxؿpD1ǎf\a3zgKspCg\2,GtYE%3T)bΩ xm2M'ub OizO(4iv  EC`uk.4RR{NfM5ԨeR8=O`I/Y뼴c?ZSWJ x$[;)@ W ] kZ `H39:]Ӛ|:yںTy=%wd%WeΧEcXL#Ogl$qÖ&a97 &HW(/{hu?HpZ}Ȗ/WMY A۴5\`=-;I[tIVfgM.P#og{QFn4*N`]筎+QeZr,m~NQB/aaF)x`4f`.FgDm9?-fn*mt"*̐93s$2~jܘMoª/Z x'}5SɨIBܱsS <^K5.K*MTMWlH/Rg$ J$D&HO&YTfQj3zoF5u*c2U@j hfVbyy|}V'ŷzur]rN@UcؔrއtWxM0Ah$3ՈI#'6I TNqW9J>9Vq)E(ذ}, uJ2uV[4ǽ?ֲ~S9$ {[i2o~4팯jT#-Ľu3(xEIo:II;KH Ǡ1)I3$nЕ:hj=3Hl ӈ2(jF1 (ж#Q$a&Lh6d":TvOI qq"s0v-[aC03}m_~RɦZg&ʘ9ERV/i|{mn|=hu_yv[fNú4]حRϐ+5 i,SP~T' Z X}qVٓj|r5OlF6 j;SP\\MFM EL'{,<gJfQb7oH1#UR.nF]۞k^HI#T{a4F潔d7[[ap"WJOdq.ݎʻL[XA8;#}}=481b*Ԧ9ӏf BNRc8@+Vg,6U.K˭`ٳI=Ԝ YE # K<(М#KcH\9zHT ٔ ӲH6Z!%&ŦtZ%n nMʄ~mTsw]vkzM lׁnbቦ5D]e[/0O\i);gv꼬!ߔVqNjf9#[]T&4{+샲al+e^'i+\`b݀%p4+.K,+~vOB} SH'໎SR&]k:."mn]1S999d.Ê*I&DɪCW=Zsu >ȡ ܮpz)LIyR&#G}[U P9` aK@W2$J1 1x^P^yp^@o,SE\spI?6(nS}Z%W@x¹+ ~eVpcӨXjsl)P4ג^a.t.َ̬I,u#GoE,9բQdR&B* $m8[^ ,*3X?n"?M!ILө8ma-jsk<~긯zJhCB'lO1ZiR괴Ki-[Z;NMǤ*ʹ*D.q9ez;bK6#`٠Rl42\TVb fR(mFAa}htArahBs&r2D62;#Q*msfٮ-%>P6pZS|O3MhRmL& T*/ I^Y7Ԏ+G+"U! Tkb! b߀Ap_#NXkG !ȇ3>Af1)Gٝ&mٝ?݆Ou>jQTb]n&  5.ՠݑœ%WaTU$6TdZCz A͟3P _j৫*} 1 4Vr!Rgfh}#U7r QomI )#幢 N8Uʹޟu. =ҬR93OYϳOI.tZ9u$0K(9{P*1ᶱ#>1l ~qzYy}8+抶3!*LURK.`d[sxoٖ9\I)ICFP1ٍm0P>9W) 7@`g]`ΆSs({M{LSbqW@5&70K&/j_m|\>7K)ϨZzFraS[:o@.8.vjͥ /V pW 7g98DG )AL%/KǸ,Hl %Tn/}y~ͤzxxpr<~/twzXMUwT峳`r"~Dݙ-ud}eGu,h/ϔjր >ә:a'9<6Y/stV܏yp$%~{aMyfZzQZ1KdO ׏8K孢q4ی쀹1kKJ`XR勹҉[~KuY&1FXo LJ%>5 zE1%H/ln.J~BKQFadG ap8$7rWęHfL~3iAfo%Gb8!:Q@ZlRv+m*o:Gg7%B)=P&2]ӂ:h9 /2:j+0{akTn ]Czs@@Pqp\!v9IHvmgFu*_Gn;~j헤Wt w1oI>^_9K^MZ=3*GKlOKj;7uukG0oo~,ۭƭU ktKMBH3\2؀AoNđJIYVE T ?soX2P4pNU]8R(;nLeҐF_* ѣ0*m(ۤgCNtVP4 }rߨWo TOrOzHh|@kRT~ }A=U Fr]<dJlc{KUzhW?H$cc6vspi@lqq[g γn[Ie?a"C>B`y2otBfRW%hZbMTEV>G`"MWɲUDŝP"|xS+uw/a?b ֠љd!]+zR@;L|/ܳBgnK+0:M; Foi%|3*2T,pi7a{uD, I@?rdg^icݒv!d{xe?Iql.tthwYZUvb@^W~!+(Z7U* endstream endobj 162 0 obj << /Filter [/FlateDecode] /Length 48054 >> stream HWI$ +pӷg  }9H?ȌǒYݘn1@5mHK[!{]{_@0CW{K2Ǜ@y;6^{9J{u/wlwqqq=qۿM쾲g|MM?ú~>.)o2N{b.:.CQ-@3X |{6@[{}kq:oO Z볋{LXyϝzsC 0SR[pf99#e!-$I.iGhОsgyLOyڡZ$yVf p*2PA@3G;ICVIKq *Nڧ-"5q(MUė8MX?ʧκ p ;Q2^, 'l]9y_L{K.yd0B!b6`>, O^Fㆻ?ȗ$'gL3^V˽VμbV1{^9*b0d-֊, )貰D* Rbn`/RoݶS v)3l\{v[%x"BZe^B;6R@)I3l/ vHFfj):Zz)b5KT1Kq螧FFy*6/Xi[̍Zvg| 4 ѽ^^]ׂ%urUOh+=uE+&{v}\t$֦Q`6mŴ.pt21/@$ǐ뗆VCKG/K4qt_QZkDYj#B:])Ks}<+< !ϲ[O[󵌅y: `dɔ>t8N06O8kõ=B*tX΀+:;Q_pfF>Z{FG|=R~a^`B$W"pfHf +F\1Œ{J)(i 7 mI^ gbݕ[Xfx\oM^dcBuq51VcP=U؅2Yuk?p@ӿ@rZ"!s[_Zf#[ApǽkU(Ӹ,tSsA6{jV1J)bօvaS8pqɲ60lptUl7Av|:k Lդ ߵIф 32Vz{$]SQ,'=4ش>2]v'v'BU:@CJedEvDǕjeJvoHĨw,Lj>g^/o)BaRRMLwIyr⵰HOآRɛv(l^\۶o h~@y5GVԺFKmI% ,mxEb-,k:LZ%+/M8o9a**1v5'b}Mtp1o @jMiV pd#A_H3xqwɯ-sF  eR?R [+_P?GA&egIXO ,}B:1VЛ7{Gd=cM|> ^H n 5T9lAD=&XDh%?xjű V"?!v_|PD]dm l6~AbS?VH7f1, 6t(lgvo5<4QFnqY $kaԖV3f=XJ"-k-y מ>0)SNk=ĈUIfn•gޜnn~Y%Q-_kfjC*_ǘ$~z@j<7v3 ~?%ϛ*x H39^)"gmdYeݍzfuLFXo^P+nӏB@thy4|{}]X^L`>@6kT+GeS=X!,sd7Gõ-UO#V@&ߪ ejTs];SoK2bu_UH76,j-y4tj 4Ty+|d m fjw6@8.îRԲ6&Q/Uс>Kfg0q"X(/NIb/ _e9uU|P.C@;*ˉD.V;3$h4ڼn[ FVfn;5fv(o}z)}%+5 Np71Fm]Sdiq+9 o[[w{pڌWl4C҆q "bVݎ/uJuںzXnH0w{ͱRb8`cלt.X:E9#^A^QJgIɫ=z2Oy&eЋcDwME3n5cBt4-$k Ȧ!< ^jp J2 ]x}i 9;]9GyZ, x6;jmp(XߠIukhݔwxTYUc%%?s8F7sgɦOyYJBۭf,9kI}?zk4ϫUq^mffoɰoOjj S*9;dQR{rӠ Cq3[ْŋvOr_< Or2zmfMb"vKRPU}$@Ԇ_u̦rQoETyXҤ蒲,[uAȾB伦97'ŶцãsJO'3+v!oΖV|kIFFgb67Ve56=eZjO:(֯ۋLv8Zʂ̯׆]ź)0QM86{ں^4f*p76_sL/-wZAuwJ+!t_@!F+0a]r7*e&~ŧsTKV:Smm30Z?_TcbԌ+.hw=+-b&1Ӏ@uUyܣ7\@4R>D c+*S;ej46i@PAY/xYv3Rt@ϜS_H**ŅC ;:C*n7s@aCw0/8DTˀXe0%]d+6zSMJLqR Ƅtm{vI B;԰VjFjmd[I8~a^h{,17RidD>bEѡMBC͠[a(F9L(7VsyݭttBUug.8scR%^ h?-ň  ل8t@18XY ˝_vD'%:p0.&5ƦQvԔ.TO@pܛ> G=E߶Ǿթ Y! < nLAœ>Lˬ69m'Rp @z;$2uRE$g LɋgV4t% iC8ƸjS ޳֞`5>E.JaG Z()E?ypOフv'hw&+h;Γf;uHK'M>k1z"lCBztz\ܔq+='G}E͸:>BV8̾cT(XBPs;+{-0F>;7Ԅ&:B>Cp *ͤ]]$i+8^պFϔ>Xӻ`*lUip厼|Ekhk՝jl@~C/{/`bz˓z6Meq69|qHF4F_;ty}}n*gM7z6rEq4^ b~Q#m704`RbBd J!J#E_ݰBa`KLeCe"x0 ]#76{ Tg)Z +Mu.[+7;𶦍eăghb ߤB_Jc!v`c3N{z!xk/ \dWㄥ0hG8~}xr-K33^vkbqG,y/$9~EY4aȔ43:/J"8T3(}e`ۇ< R #q$IO鉶5}D>e<7gեH~uZ7??^mqiz01`ι@m?|@A넘룍6V}hgeշBˀ4l½rnJ)syw~QgCIqHB'Գ"jJscČP}k8àrvh ?r2Do] ;[k7Ȯ٣luA5!Xj:>rFeikjizj|]駵L--( jgɂ,7$aѫX.:͞#5c|+&TH$E H/Seļps+jnmOXҿn=y'G­Ȕu(אKuʈ/̄/eHuX)$O#%[U*bqKKdg-ڝ$X&R+>ΥKQ.GYy,V~19`teXrȋjjcX́/R>40$!/ =lmKǍl2J>SLRVI1*Mz ٯJ~e-#?צ ze܌ T27p9L@$,z* B! nr;5*hHT%nj2nFQV9䴠zJKA ˃~L2SԛĒX5ç+rf % c֏=unjf Ƃ{j! f֑z^Gh2?d*Pf MΏE/#.[I'wJc i7/uc?Gr~xlG0 ${ˆ _Ͻ )+D[95<8On~б[0zi Ӷ_B6,ځnJZS/a ̶D@wT3];df'+tiAwJfRƚ'w/VIspGzFzZFG - 3>cjB*"(P(<9^ 4+@,'|KnKK"1B&f{cB`D-۷Xy~a,ei:pJY%!jOi*>D hsjaJD7ÆNej/\/K\ ^o%)>ZEzM`7ϚY?ihdLfwo!n^ ^2YAB*Q44L=+-p(`=I^ϴR[AȍzT:?zǼl(IKapdn8ب,fW@&}j&v"ư&m MD^+JX{(yҙ*Հ On<9&άL6j{[oeCTG#GQz (ʥhw2[ѐqa^(2= P^z!/Lz>nHCk=J*`%%JȦyJRㅨEcG›Q3ԾNg{iND0}s+vujl%肉:!4v͹{l悧8uc??ӧMu Ho'vRw8H{^ ,1Qus>M9" 2u*VU9BvBA #i^4iTź,2)POt%|oӽPQ]Y$QRP=gϵj,;ǑږGh6$8`dB7Qx9˔2װ03,B#{|i;q쉌]rXct^[mm51 s&N%{0#o5fw0dv Yc[GU1K,7?Ikp}恜/Օ@g`Qd"q:qZCeJ),]j#haKm56ɃJN0 b͘$_!@clweT.eO#ѹ=*˭+YS_y7rs2ԛ D1t*-O5TZz^1eTfKefI!ukYB j.rظн)ƠLV) ׀*Ϋ,2X3 VNTUHZe Sdkl0EC8KU}{RJ.l^%P5]0}@P}|KU䴊0ǎ|5 3ACHy[75Hbz~㋽rO Sd/"^ͤgĹ}_!dr$T6߳ <|fFT.<~VUuu!S:tl_ 6=m44LpGR f:g%[[0%#ʂ5o;FŜכ3P  4Ti3Pyj9JJki\qsh?}Ja:$pX>p^1)oQ +W5Ʃ6YՎ*ѷq`<#~?a7o'iSV=w2 ! Hܼ`hȫ/yG2ۏoCY VgMjoK-L|+֙FUZ8)\] +oJ\VuB yf@],Ozs%dy.0"^%NC#6}~m9%wHc8/֯f7 P"<L;;`Tc0#7}$Y|E0yK nV4e@C#If^ȡka(K'i>4}a:)/4/- --JsSV-D–$za:s(E'>]X*h=Kp_N 4-ΉeVʕ7 csr֫ZHnq/"oeL vZ* ydx8hEM3\־ڞwkx[veS=abwX3$yxX\{s$FUw|%XeFGH@u39&էPwlM .$De-(H5')*K}"e1yI7X8*!0X+oE1/_gǕ %`1xN? ,Ri[NEcY%#'2H9qad)r@"S=MOW @S W&+`zٖdRv^BT⯗=KPBoEۂn=鷗ȅE`(!$ޔCp` oKsʴ-u錤<̕ K:=f)P7m F:9%LU]d[ֹ޹u :h){%7fN.\ߓzr Xiꍮ(&6(;ag S*@% 2_6+v+irpSW?Γ" cR Lyj;NWRW{v(UngVk<-UYmPwT@2eQ;Vy$g`aMgNlRyV[:yR٣O娏;ܭ)J͈siM ]*@ĮMcs=<Tbl!7]&NwC7:6Ko)%bhrs kxոpʮG!3QmOyE9ەjsٔ̚Rz^ע7( l]zgSƁBfJһh&=Fû+32l5| )X`=hrAʶ@ז3/liȑ#oq@{䚏pM_VFfJm?qMQ\ HE!IJ]1YTcqhϭК.E6E~}s>"1:;]B?F x#cc~ko E+PkהPv)(GRŸ#׃tu9K]k})d\bYLphkܮIJ%j㤧_"u v9N. K,ƾq+igjZ~|ؼ jof_gPzeB gtN,ܲ|-ALPWS9^svTI,F<\Bl_pz|ey}$K<봳i'-v2W+zX)mt(g6z :=}OciDpۧFPsv2+69O>W4Ic: J ]e\Tsni!rkGX`@`SU]eGf>fց®)9؜{ػڀOߴhYQfo5C*ɧf ݑ¾\tD ?2c^麹G֕|nG-B X.[ou2UrF|e UW;ł;_ 0׍psg(܇ҋFzafjpi؇ϼۥ"feIP@Qܖ^B!nKپ-o ~]~=XP8$fmry+ ̆2S3kF#3I U)G0šp7[>m[zwn Zi!d}ŪEҸ@sq`'upDah'9 U+0L\AQY;w]t?-v&݄. ,tc\%U"%w_1fVUC;3S@cbԙ$>(AȤwR0X,uUKzɑ? v,F7strM7SdDZ_7%lgPg_^n%mL@Ҭ͈JgqI+rd)Vh>;BK`)("b_8Cȕ́%3jl;dDSPޝ`n~v:wg+]_:պT ̻➲B-i4 z> 6!OHJlm#;v7 <%;f@y2few wz~y?x./pNF })tA>˓ =H_t3YEo.]ּM6djLW^yV7[V҃yt# R/jD`Yݞȗ*;h(@Cn=+Q3OIeh&G \& Aؖ! #KX7ntu^LsÕٍ&6ؚ$8Zc tM * EguE۩cGGGŪIr9^j 3j_$G"b_Ѝsr3sό.[ +33sss^Ҕ/],Tt]Pj( L{NXi̯cu[໯r Uv!xZ_~\Zܵ0|W'ڡ5YˎB G{GuϚlhJn)eV}ɉ5b)B.SgFƻןw v`zSYY5MWw1dR *%YEZa3Lŝu=xЏtV U :-mư~‘i1z&ȴLiKUDpٖNyRx :@i^eUB+4ئ-U>GpTRzsQ\g&uL:6U[~=,~| uHxUw|1QeӔ(tRk>VF = %kmӨtk2NG,/|rTrD%ZE9yI}Ӥ:)O8:4дT@e/^Pe gJH풌 Clkִo)mToʍ1VZ](gfÔ(ɍ[( > *[Tmj g!wS9*Uw:T[4g>!]b8 :@;OuO~<>8z9h|fʀlP=XfHsʶC6͍%'50 l{n-iL׭ al7 rCaśG9`cV _Yp0ֳZ';LT]/qhy(h/,]o51h(hO^^ÎoiPտJ$:OXn̔Fn1`2ɸc|Q6~Ծr4k5YGvd>\',T\̰['ĭ<bjzlrv\t$OSƇT^m@kmgr_Wy;ik'{聸?Yː3rb#X9K &Ewr,1:iɎ# y)chDuR+ʅ+7+dV9r,-(\\継mE҇eYwxUκTC*B.De^O7B2TOY}aRzLi&g|yl 8߬LɎE6m&5vF 5ұMV$kɈ/qwtpL#nԝ;9VKd*9_,Qӄg$bQ(>( T Dvע:τ1$<ƠI#C18NSٳR3Kj8I3|ZμRVMr7d@{/"1U^_X%UIB6wKs Sb1³v r>snm; d.!g4>CN>ZɪFPxZړӘH+s`˱0CD&=(e`.0]R,$һ4>ɣF qI֛Ƒ[%DiMPWP*A^fMMؼm8f*^JX;|ڗϸ3۲* Bgk6:.DmDc3 qBWfo/!!f{:D! {5%vHJzjҮ`s|!fj 1%I?IV굍x6OO9HCY:g# »MOx WPÿ߹:܄ԍCa]yٔ7 ^lK}]) ޔM;%A-ۿ]T/s"i* 8 OFTUZB9ZQvi0bl:"34 |CcKt1x;^][,(/.{'/`)&0^٨_[-w [ȳ"wY{a\jΧi/l6,P^c}Hԟ` ^X/ݷzP;pjBW{kVֶc2۝VdIK-HnO2B fŤ&WmE+Jiiʱ<gd~l,od(&~Ln6\,HGRC:]vE: mR%H{}1C_)UiSDPr%s (}(SǙ\?gzGku[1%AՌ/brz?&Bm^$䯡;hSTNnk;@O/3g`Y ) > AZMɍCӬcIEMq_{{*md|Ey %AMxD6e{P ?[#u" ^C)P+?nanc1KbJʍ}B?@{I@n;8E4zPZՠu0yk7e !S1Clݚ}ޙ0ѭb!RguIBþ}@Z79lz`4FgY`ʦ6DZj4Zz4xRz([7跨F ̣:n\2?[QZ Zes}}81Uur#& ܵ0qlDK,>L-pdr]K];o:=4q)RƾyBhYnӑ= YĵMσ:UuMUu䣈).M AST%ƦJp.첊E@UHE\6n-5ZFZ9v׺N Le2M)OB DfZ q Rpja剒b1$*wC^N7!\y@=-Rג: Ouq=5d ;46mKjaO0S[*ZO=uk\1R\\tXH<[2'֜sUƹfUi.S kg>:4)ڧhDz e5BèpXȞh 5tH/-? y2Xa m% .Vގ r&+53I|4@Y7zä炷dpEnNL͆~ykkah'xxgz4!]gt7;oC`v퓣C?Fp?8|87ak[c_mQR}/ڸ FvYzjʼ`2 <~Y<<r =rS Ui+{c^1Vf"ۍUz%8XUs4xLJmJYZls也z{%}I> t,re@۪KKW&m, j$MUVɸ7EPa-To _vK@HkZ@tJ8KQuxOv?~fjIl[ 6(ihFxM[#v٠" 9sz 4x~'B,rU>f'y? 7Om,w` M~Q{^ckE{9+#օ8kn"^U^)x|3$ZDoFVL94;HeQ轭5"Xz۔Hޝ"_O_`jAe=x@4RyLy~Q~*`F }۬Cfޏ,pvfǼ!1!qwb\=^%a1$8#E4f162ՊײZ a2=$m=i'twٗk8EKzhntυzd$|I/\xB#0rGϫ1؆J:u* dMvpΕEK;[]ͦ!VkMV( j0TpHH_i@@E声&l͌ŝuϬZBƯ#8 B 6Bvp!٤ Y΋(aֻ9 }[F c7!bRʃFUs#jZBB N%)„Ezu6%{R7>ّg߅eDpX2j5tؐ,:9= -..178b^S[};Уx 2 FȤeTZ`# Lr Ҵ~{di68xH ܟ3!nN-0 GHi'HÀ&ZoJU F.tTwa!ԯ9Bq| u }1b.ͮ @ Tĩס@A0J]_=(za2_0s;f/zY&k6Cy{w h +ȔC`^T]*tϲ*eG/!23.oiY0Ε> (CLmb'IDI,_ia rWSAP Jj72BᅁG^ }1 1G8;3cǘ`j}dK 78p=!Q< ! I Z_sv{,#MwF#Lbׁ՟,&MyxqXv[)&@å/HyX:iׄS#X91;Fq%u2#[5V>m rF$8' 4^3$+5l#P:N=V~yV(b@E16RyxaM P5n5d&r3TW'bi?cs}Gs&9}[fr1`" IY%̄R0}鑟珱>5Y=3ꙗY1B@@Qbgk͓>;}]ަU=& \I;ڼdb"@;Y>6>V#r]g-{ژ  mCet4)AzҨ%gw"!*b*>.A/2&Q<58ΥO$G(hDϩ2? ͌{Dd > yJZC q)ѐG8H%4j̨F?!CK J0r'/g%m p5Ҥ֧hY+ls]hmmYP,I1UOГ 'پhRb ̗۞*e{"e̋!wz~uM"ۖF'xR&|VsËQg`|;h"ٜ;f W6S:ؗmQ{H`.̷[em<63>*l/W 8~w( Sf}U@J;K2:rSچ\6~\?x<?Nt}xx'VosZNhMd c(EL Sv/MBSĬ`{7dTo8wFkD/sgjXJ ݥ1jeskBzB>#Yؼت.*Ǵ:ɞ;^)I칹蠼rVݸVX7Pj:iީP m҅SeKe# MR\uOhXjI>p#"k2 k9bJ"f$%Z:J+eZRʡ! RV䱝eLJ;^b7XP}HpºXwl\ZCǚݦR);Qثs]YXy?W "$7%L,[4!D=#KK`.J5Bb7J||Mj/\ϥVژ^gNGeEc "6 >#T{>d* 0(tKlpa]T ؽ|oO(۳_L leհu ,ⵑDU2IlXzH-J=٤JI(R l0$ل.+J燕je\XkʺXKag^eϽәe6kt[VA'~zw 16zwX#?U\{*z*AuOe Ӡ2*_ ,UUYFckݡuCp58͑UCSBcbs}+ S䲞&_e= %FWP]Ś>pxolH\gU҄M}P{Sŏ!\KI'])ۙjP$YmFt:wN~!ik*K(<6eSݯ144ۼu%L%oS baZCaFV殞{ޡG.\@|}[Zo=b:#yB6mxokT?wӗ0ʦ}(/7hZ,6/M5~}Ժ=C#\{&"gۃ^ mkZ\{dd@x 'ișzm}QSNTmVWܰi<^{tnIcw V|V! 6e'bj515'iFAK*4{Jb$R;Β7Uz0S V]#M$Jv5aSKg,ы\P/p Z_ <'<';8I I:x!SO$n o#&v,s$jTkƂ(D~XΩA/5,Ζ⃂B],ԾV6m9T6- .|SN;*MFzʅ(@,>>rn0!à qrPTYt. P@~c&rFl\ws 3dCu:~Qȧ7n%ۃ^MR+2N%|R&7ҺkO ?W^h@,̯;+)m-Hs0 T/+$51%<۶)f>+{B_ զH(mVͪ%PLb|/b2iB'j+ry˕1ޟkHRzY-^,eHV#&%ǎ} _ %#̗﹀F)2?`71pB@Ykl&RYmm-K/b+Rk%|sy[>4GVO DG6{h4`.bUAM8x4!%>vkK~B& dӨN{n x΍53%!q!Ii1^9bLyVGJnwmi+AVeн\CH5}N|^C3$P]Qd~Uۀ$E۽+`͎"R=Ƿ ?'AP|t?M|d@-XOZVs]Qa4" 5eȕ:SS.E],(HVŦ.XO< %41ޘ|~M,xidcc*$?[T1mͿ x~n۽UV,Mw'w- yR֩O&aתNӣtQTw6Yu^0"SX5"|xX^M5f.?P0o7y̻gg>Ө&}8$)<Iא0tA\2[^KntL0):+΁V`љ,WyؔP{{B%4R& dɧq˄ " Q-]kDx[{/3ϩt{gg(I6"7Q:<44;myJg;Z~adǤL%́*yHU1lN19(lMR4C}QU PH=y7۹vdk +{w2(Ӻ+ ] T3`y)(BG-k)w%n:'oTzRE?ϷH?Ȍ){=%x% IA;wc /sKe{@6UڙA+mM#ԦhfբkQآ'@xk򞓍YBeڵ#fJ-~t)*Z# rcq77uG 0f`smNB^SBG/H=o|<*oscvrDswuـrO$V o'?/i7_}Izq@v&eq98Y@vGm\$ :숗8ڑb R֍^!= ٩1rpYΎNO'^a~>&k$b!ֳ-\o0F-cђ'U Kت qR#4] RykNIsJٰ!G"$85.%ԣ6-ͳ3D-cdVgЉxԌ{sQ'pdTNt)E'>[-\-*#f~{]nz4EZUW(`4Aj֍<`TA)>dݫ* 'WjC?Z-smO2d.g[)`h2Sv) HAhvs$*AR?6; .߸05BŶBpPŨ ?:cC(.2Q=k }ur)3IQB~7/rW=@C).Oa]Py3n 1e;8;$}D1T/HZ2Quߍ_ײ$sNjjv*Dmi+l9ړDk Nu"qQZms-[)ߍ:Zr-$D^/3 t2[jB4c݈SG=8&jK0Dd 6}fΉ5q/U"u*Ҝb043m%ʨ[-4zU#ǑT#=94/a#8Ёx 눌W3k,-f6cЮ̤˭g2Y$e$d ` ]D`a 5v:#{/78 PU!ZfM.2nL::`\qQVfcLYTZP~Ь\Ó`:Jf-yR? ?.m9EK9bu7~:Qs "u7z]Gs/H7/Bkޚ#5TFp@ۆfCd/%yx]5e2(9vdsHg}O?5nڦ,v{,bY?S5#+RlI]c*B]F|8%RG\]*$ȹ]Yd/3F'ǔr.lŜq) X|㎯F_["T49kx kTH1l3;VRW5c ՁTB6*yYF j1c Dr赏pqzk(Ax~Nw \#Q%[co!ynUL*TcVB`VIޤgQx3*;K8YWG(%:YPB˨% Mc:jç/P@aD ?%Rj^7I*%-8k2ɎțAkuUqA `o%þZh"-hn@.[Bj,_^rib~9lSQ #}I@4X6Hv4yD)S#1c)h YȔ8@;F0>4yA3s]Q(P }zuϴH6Bz.DnhkdG#.WF-ƬҤi1;oY]\zjj$5Ac*I '45tΤ_/(\[o3gu}FnRHN_hy/Z֞rkzC_EO>kΎl@TP8j{ YZzo\t…}̚RCBKgP28&]zQ;(J|S*|IVaw74Hz"eɫg޸Wӵ.De^l2M4o5i jl' juvtCP}݌PydawD% C EJl%Jw*w 2PZRvR2!y$FcY+XW$0UTm~\-n㒿w,,~1䯛ligCeAݛ7bÞZa=VLa3څewd'?K͓f% Y'c#"zt[2}e枊Е%R/LcnXeyFqz L0>n3diK-\jt2d*;J`S;jgVI(b 37ʡ(jv-7VPQ*TRzΡ/"UU9hdUcZ]*JpQ %:;H~MKDFL14Mf7n̎7MTߓhT7Kf ؠZ *#A$ӌҬW15Gp³K Բ93cC)Ns=\8z~:{()TIV>h@HV[(,AE?[=_#mXil(4e%ޛ C69CX)!Ǽ$ ds$HuUmtNb4P L h)b\q 1 Y:*h(^*u%7xNf$͟Io]:9us=CD?>kVm]F"sIҗa]]hT$ nȅy(s{a{{} ݟ*h({#h.6M<KO3hPU;%_ՠ)%"H}_e+iqiۖ kpk(nֶmgz̮2k\ nm53*ꣳ7dVf6cST3W:Y4?:'5bT0sw&>roN&i:=rXb?2w`&"e <ݽV ݼ;!(@05>aNy\9;s1BvTϬ%RI‘\uK9~MF9q0ao<_~_)b=: kR{ m%gO[Z"'nQP ѡ^h< H9Zu\+ Ћwv.m oڐ[: X^c^Q/m\hh~s)VH]:KN/UIߗ=NI3P LETDbnF&yeo`r \;jL~P?ee<Ǿ]-[ȋcbJrb.k~6/nHtIpdy"zEu uL7 Ae}($2D.I96a5igVO:.RbXmp V-j?Xy` cgcҞiK[PF0U1㎯&jM4%R_)䋧2r=H'໎s+YԵ6 :XeoJ5k8@(y7#J'jc02J @5RF Ȋ1y3 ^6/e`+y"oe̋qj" a%`V]f"]&-7jԭI4NW'֙a~mfeHۺЋh60>!Eɰ6qm\_%$.tUI]Xc.! wONm9k5FWL/E#{z{یǛ=ϝ*q :[lsrQZ}u^j znV&{< Ӷ pwZ 9>D.@!73"?+Jl^(Yڕtvڊg|eTqNҢJ9XJ 8&,%{ska'{9?=L?3Y}󺛦me/A%e e/8-37+$e/#>2+tDaTr7}HrALkVhF|A܇XϺ;`,0bf|̹3˩ſl9s%νuWݯ+bQ god8TR }ۍکhЃ4(?op{\[eޕLͶ/8@ [4V#H*/iY| 2S>`_~M D_詭\ 㜙FcvlU?V5KMYF_\Fe#c`a"47J@HՓ湊88ЍL<[4z޿ 0~a)nV5Af+w #'~']}Fd |Us.tnqR4bIO+D#Q/q*k(x)G=ĺ,v]t~~UeS/o!7_izuhi}nIw9j_hx2ap_ R\f5TBŏTÕK r<zRo 律6TBw֮iVJlCg;VJz# % UdՃ9bwu|j'1'ݻ%F!tK6AQj GV{EivKN +u'f"BN8<9jq%2oDH"\|hV 8oI]ZA3jU$]/?լe+'[p(uuK )5VYf,-欎6W1҈J:,*aU{~c>mϲ:C8|N(@146ue@L6pHNKLv/jʡVK BVkzLb=fdVPWqȈFΤeZHn^ȨȻ*˵ϚQ* ?A]cP -*el0;ʣPB:?.(ԿRˣnfmZɶ^XY4zQjI83floM'"j-m}A1aݦaǯ]K&ps2k1x73-ꘚ4CVPJ iA|PXӨbrB5!)VnHr4I(fb&*mTGh´c^2}lc0gANA>Db'#@"ۿ+uۉ_ϱc-#r]xV$PJCEgn렻j;D(h^ h?i,JhrWPALvnLZ'H9U㍾k/LoevP<]Hlz(:J)J6\‚bA -ghBw3=:4H{wpU4xzpۛW]Bi6Wi,J`os2A}Ĺ߅t]w9K++!"d݇R@=^D017Jf}Cn=?M=Cm/75ߟ[V$UvSkG+Jlrv¯$wU 9l__QqMHjb'KH2(4)M\e' uG=tuo@nE "-nF ,CɰݭW F.YgeMS’fGV nudi|V8«g(\M;ފf`mXpAܩ8wNB01Y {H7eJFPF5Z s^'NفXejyfґsc3N5;S)s`Y4m.1 "V; qv MmS 94USڄ28!n{+jbs -Dr5f:yU0 wxEה{v"gےv> f?ϩтoiASQA; ,8,EGEaJ%YYɏ&l֭ByXy2%VUJg$QxPO[4klz6ɠlG9GD)%BdPL 7FyngצAA1Qc*Z~)rc"@($`gԤ\\Kˣnh@cmF\\slxbc@떂̎Fs:,9PO[$IdĜ8? ^P__%$Y5ENhlo^w Y_ 7M?qpN&t8v ט64~`%B)n(Uﶮَtj[}A3 imdT6(wOyٴ@el'PV0eӄn>.ןЗLUB %t` $ϙj=lJ⟰`dSiz|-ݖojN`@{]Xk u dQڙV99'9~ P# Cmq*'_p# PoEk+"MR],VKF7^h|sT(L_-3Æ=q{pfj~ӫěS{*kl½ۚ8b@gW^g-ʴ q귑B Ȭ![L IwpP80sm[ kkT!5\"Zm=|ç/|j^PU\kWڬ/Tg1響aVPC{ 0DuQ ˤmHn _/NYpQO~IjȔdlv>!9Wu{nD^sX6'5!\ G'nдx/0$fP[s7˛鉢:L+F0aC2dj 7-Oغ_FĥFy7S[-®Uف+uz j|jȯ..mhj',+[XF*,m`-, f<$/I7U[- Ġ!zc%Y~q_1h!= jFU=d0 cNØ΅K0[.(oK>v vi%+ԃi(F[ݎSd3:Pwj pf[-$t(f- h;a;>GWZ_5=ǑiLoc}YتvTr;v{+ajLZ0hpQG\ab4 d A5tjpwt&R8]~^hs¢2KHǯkwKNYLeoJ]2pqJI)wX]~ӖSQ}g\j,Af A.!Ruc xS6;Ռovȋ( ~-n'Մ 45I{1U"U~Y'#[q1~%+Іh*+ &}TU/Z{:0wiꨤ"$_*bUCP;ۮg#8qGvF|cWN5wG%S^#2o$)"+N#uH<#d38pJ$!f Do:/ 6b`3n`&9-=[ڼ?pWx_Y8 g"%4j}yGh]GR|Mn9-o0Q4X[;Dυ. -MjRjF-5V]ѕT-?AK:/hH"EOVMsmY8+]ϬrݟGѴ-+6 ;+&ݷ83F\,"AFT&FVWȮv5#vYֽmQ{Hɰ.FZ;o'_]ʷ={.t3S$ V _&DR;Uri?Iّdu{ Y)Y$CG:=՝ƄUz'Sφȹg @Mt c,ULF/$MDSb6dTo8ʇzwD/3oN]z}V-U8&m$D;+hdU9o>;ϔ(T{}퀵y9V+Ew-*C8F\ij䪹BRKrk!c QW\s4Բ4!Ts&mGhv2Uz)U%M@EWZp^X*-g|ACn\Tu97$HxqiqY\kzXaؕ9غ򊗔yakXrX"YRlCԣÉmzM,ޗ"ܰR`.5Bj_1rO\Re]יQ]vt[2C-:B-J J0ER:>]X)U#:[՚{ɡ>ps"…bC./H"r媴d6o!Rf/0dCɶt!P6i_icd%~L|[%>Zf@3{t~Mne:J : O=WBƬ#l>;zwϴRM h%_oOV9OST "^&.AWe2Xz)UYFck$ k~#F8S\1zιpb4gW]BU2ԯ.|Ex8<}I`]:9Y8aWhTk)$-e;S $ΨPftKPswᤫcW$XT dl6,Cv`X l6xF] SI?5L0|;BZx?Y4zzuro= n]k}id nk?+A|E tkT"P`hG-1Am^ jCk5ghHÑvv/$Q=8Wеllkze *'6So6|Éj\6k-iDCƜ^hq0[ybօV2F&"(p)@4k=%1mg Uk);w.!?H-1bΔ03M~ y# v_ <'9<';'?I礀qceK^ c콃L >Qz%܁e. 63(t1 yծ*@X'IԨQ]a6r/@v|nHA9F!u&Y1:lXZbZr+ɍO ۣi5^^gJb1j)gcpoA6j~gA Mˁ6Zj~vbG`j CaTQ {BPz t:,ɶQ6Im *sǨwt̢TϬa曩탠[ iƶRįrq^› "gxp'msZ.n6*;KDHr Jҡ]ia~- EjC8(|^]&fҔK+ZW= %a-G,17a&dqlDaD]bL^Ġ*0ݡ~lJz82{wo!2Qe*%J2\Vi|em^N #Ym!opLT7_!"c|ML7;]W1NMf*`ƕcƖLD[CdM`5*l4= 4|IhGX -Ed'<;k$<4Ѣ4y*>f1فyoZS\&\9p^7ҭVX#ĺuVZ;\Y>AC?yG3#sIuct [QU,n=3MZ\D+3;= PJT,>Ghٓzsxv+u^PB7%Tem:cGNok!fvղ?(htWw=U` +*oq@q*ҝ=L%Wg캍=Y>DgsuBV pI2e#f.J0Pjw䆇²Z=0%w4kdHA +l#z#DMb>,'sDUo`G}i)6{^ƴKjsJ%Lzn?PT9RɲreY; Wo,?zP[QbCȠ<A@#Z\ʻP{i,5 bP{I'}WۢYb9#sfJjL(ei#8g)lNDrʻtA|{(NxQդsDL xzFEAKgHF6vϤz߷ҡxEGIǺ"9&kLi7zv'<$՘ZPBVUZa܉rC3Xʡo%}f -#ƱV ¯$>נ[_^Wz_cOohܾfz^faʹަE-\rIȣZ6rX{ Ca"LþWKc^nuXYxkq/w ;]̾S>0ǿSAB󄬞ZŒzo1e3m%D:A[W5|@Hc LM:\no}qFbMRg8E<%ǵQ\X2ū^ܢJIă )NxV0^.po;^uX2ktJ# [NT;Wpդ:)Yۻ !j;@_HPH&V^u^P+dS3NNDt tA[J&i}ܿ{|\F7gI ﬒ |jRĝLX6#]1 hvqumlIC0 +"EJ@KhF/ܺ-[ amo¢O8Joۧ8%EJa46%I̹-{<W[ j^ߟuۢ]Nq9[e-Կj;ϱkKF1Q%?&r{YBhü\B."{Tk,ٜ!kcW=(vt@ӈ5&zvdV?|DЅr@9S瞹_c}0Э[P_XjzE}SOCcUZwbY ^NݴT(󑠚 tA6;$ԑp)n@-]s<ڠ4mY:mr2I]N Zakro.ݞf7\0bBʾkMF%`h1`CtntcZ nSjg>3_9dD9E] ˰/i#B wYi3@.xby;9zQU zTJ|LUy82#mM3)kġbTMn; _m7aY!a=FeW?+j{ Jޔdl\᫛u秊U^՞?UsYQդTyYVHV 䇫P.) Z*4~㑮h5XW3V'Z_|2}lIWP7zis+t m6nUZ uȷk-עL[]uhshLWUwّzxR QrL2!2{m.mq$PaX=I]ߨ`s}J.Fպ 2n%u,,!~N Ǵv&U<6h$>92KLJ^nY*q-<OMZ'<})ԠЁxX]? @ҧ~?zܿOG5{#M#8YK*8izkOm Ls2I}q?A-2|_wK`$/Zn3%%PۧEOzTvj;N/F v(*i^`Q'44XBYǿTl`/i]Ȉ֘OK69ߥzk,X\k}jx_bh\"c8yQ8xQmt>i8%!%$qa%J4T$XҢ[U-n/vHoV}'(0 C({)h016N\=g4k!vf|僦L+kcLŕ#`e[Sж-Skp5roQw>N/v39 1.`?2l 3 %;jR0EșV#'Upm""ҥ9ݣ24,R:v9\2AE)~AY^c(Kgƛsjxːr-=%dncYVo"3`J#Q췫55BL9Ͻ ldm>N }#&̑F$FV*RWdJU6 .5>cPzi 4dfksa7JQɺ.=5 q=fȬ d]K\êĈÙ4R"B_ZPX%4dBXzO)qneB-ns 4l*_3S7a.-? ^9 .씔Y5 .ʁ9&)H;ખkO(>~]+r#sFleG:!z/ ̑`J%}Kӛ7|/-xK/jk4yX7 &//ށЀB^St6ꦓC$vOQzCz:ĹcO Iej0,jvDN'U3r0/T2(ղXژgVQ\^d.@Q@1GU)Q?\^$ -@&kigeoPy#$t]a.~^dbV Z $]cn߻2@PEضբOS3zjǪRz%^ݥhPd@DȶKY [=aM oT0wRS\cNos\WITK[eea@fY^Dc_Gve=.bjܕ~&Ȋ,^k9>EK"~r&!ǝ 熔jK'yw)[.07"ň'h2ypYv S޾ּ"gLG՝ uxm|̕~`ӄ{'~+5ksۓ^*>j.,c,c-nPl#>YS{'_Ƽ6^h2wkϷV-N`'gZ`k'uO;]HA'oHJ5TILQᣋ&zlhD|-5rn=q;ê,|1WrqNkD#Pyy{ϡqz{ ?|>y7ow"/v0tPzjsVgS,6*W7vqZDQ#56ݎp^1ÉKBs Zi A|k7tI͇G7{tc[Wt/:3 L@ٙKg w?5wahAy@JV8B9rq2OO)CFqMg\D,nGMYIĽW*97#藡#`-KᑿiZ?o`:g_5.ڛF[{7s*l{`Fjk_@pNi~Wm{SfUr0? [Xֱ"akj|^;, ݂rƤعYo2<';fUo_lmjrYojztjцO?/(-+^hI&9&v'JۛZۉIYw-L; uN"psS"ܷk`wAvzZ|HHFœ7l1L%Ž .mi,)BQ#ms?}{wBA:ʋ Vo^  ZNxaoI* XK=`S"WUKҊF4.Q@顧((^/F#xGU_Md\KӼOi m`3kP$Սq=OuApupV䓺Ά= ʐa8ARR2/q]5NKMkLCچ:S"NY ʼn [=ck|q/c*&V(c SV*u_:_)Tޔ*cG58z߻xarh0Ssϟ#+E1=eޠoRh֠}{)yI]yjmȊ`69rd|ID&5!/Wzo?Lù,пΦv{O9]/cOiystN`A "Dm]rPrj`&JIiK3Eo/1ʆc/ G$"!] $~E Bq7!qMJYf={t9mK{G}ZծQְx{3zˈKAH#`xKax`vG5W|]olOF(g_Tm ȣu7O{r6zpH UR ,_6>pnw>x7D0ٰkK"c͇Y.?>2y 3&>փι[_U8T>vXXdb4]fG~"/[쑂ILL^*GSyQ֓}g" zdJ#Zn4Yn5tnf/2^CT_`A[~[ HQ@jrΚټwK[LGܯ"W0h Y|eb g{ܚ b_u@0)H|cG`Jt`QTe[*ݷݣhΠg{dA6v F;bDw#9 /<'N.\$u\^xb2e*nÐ7@MD6 kBhGnB~?d̹ApWװcFHL mlbJjAfH"͖7o|<3vL_\"!LHN,̳کvmZ.© WJ腆g{MXpNKj{ԬOW $t/^'n3cFg13GyZyi6}^FV=wjD$XDgȆ ɴhb,g$̓?C+xhrXSQG!KC28؄x4 l;69k1 )OslĬ5yH>-d5yw0>W~wbn:}YKx(ֳ :#uk@}E]94:x~=(>-c#ZZ(9~>+eyrElՙcw >ip6F!8tsn-!]>> W]/>/ : JK^Mxⅼb ;3rnL{*ӮA>,|ߗx) 8u=y)a @뽧e^wŶZ]O-LwiMNQIzp;rC<h(m/ 9yJ/XSKjw#\?q,E1}KY 7f=f' jNxCiCȜgSݨ z,ijP"v ?{<ͧO~,* U v8[Vr57UHsKGkLr]:V/J`Y#&w 戚2nƖߺE$JOZgXSffi[ɒ],IpBkT6@o] tSikX^'\NՓL֨ "{,nw̶%60:@m9l%BPɚGo7+ Uȼh]@'q,DN/g1 k5qW[:֩IC љ`$@Cb.0T!!9V ݱ,L5x#/0 uM0KKV:+dWKwɛ^7h w+(dCÒ1lA7k"5pz ˻*u#^lô#]X $?[=DQmCs5P4LZ쓯?}Ȑঀ$&#y1y=TV r5dVa|i%b;x@~RUQ3epd\*,I̝E(|fNop$) BBvP۪A> stream HWA$7+(ohaaA23-DA2j6>#9'Gyq9v=o}qTh@څ v /KmhGȡu_jM崹l]<\~}ۿQ_}fcxGщ5G[(ǜc۽)@i?|u3o}qChsU@?%*nt~Ҥ[ 9v_ؙ&`{9*G)0 _`Âǀ%m'NA[vvi/FYX˧8O }-lMvt+nEgz63O: d'pf2PaQ=kS=Z0W:4{neIP&ҶY3=r,ƟF9EӥB 3r%[0z p 2AIYWM hOHi~3fն*I@{9)Dq_4Yq;൥%40:00 bE1t َṛK {lղuxN G#;d@neql^wzh$#މ<(1ۍ0n 3[Ѕ ق/-7:gth1aW$G@fηY],jؚ[l򷆻~ sBv vHe)^Vgmpf,%EQW;msҹ^s1ąv:k5 Hlxᷤ;-MNȲum/O0Ζ* )pu݋c纰dq)eTW4Hsyg_]Ju+&4Uʾv{2F'AW߉]9̡N~qRLjZy)~`SkBu# EmnFfD"&1M޷J#c~|;܅Ë>NͲcnjrR V6KY!kD`)7VYۓD4t&dz'x^-Tk]kGYk^Щw-w-)-m[3]{Զ~k-eRY"H޳yn`D85jZ>dFWy{%SA)MhKh/܄|Qh+4o.4'1ШAhȟBC-l[5Ν%8ip>Մ, ' -y8zBMDˉVj*7#?~]VA,2 4Y爧X?!S\@Tx/y$D4\/,3D<=-P: 6m}Hᴤfv<>z"r`GY5ߺr۳P,$F(nfgL³ i׺-s<::p(J{k:r+5ԫAŅ@+ 0^O]̅w[ /I= u226 IiIbh^"淋i>0FO@W[2y}AaU\?3rO9EqO0Eq@⧫bUq8Rlă'TH>@/6Z~-_^JuLwGq 4 Dn ԛ37FtR'RN+a:T+Lpc|+*7Z?ƫm釩ZK`VKcZ/L֬Gh*q[ЊY{(+g\L-]s{ONLI%YƸ <գ];$Bs-{=K5Kj Rwp,cxfV|㿌d{׊r~J|UBKKTVk WMs{9Birl~z`aBm]Kfm/Doեw5#Pe1ʫ0up='cL\኿o+Ɇ޿]nh1yW>Kw>K 7wDYL\Q5rv/YECU[|9n M븶"*gEB;߀k p K>zr\.Ǻ:@g;K̖':x sNϫ 8 TI 5V#{]sEd%uOA1d-=_KS%i^9fљd@bKBy+|lAnimV膇Kb5p;M*~l oQ؇2\&-9ޣTnklRn^?0â1~$ٍ}. A{Gz_ (}گ<=Qᅕ'LK)bUe3,<;֝@̰܀(HHrYuC J2"i%v,%M*ɁևŠe$T\ًOIͫA[k.P5uW,66;TU* :תȸvĶ+C j W4;^(#N\/RFd4y s|JQcj7)Lܹ۴ ̉8$;U- 6$bz$khs?½6uH&Tpy` ڛxrfsc6tá٢J&'(y%[Z"txnE0}pbOhzo^ՅWGރ%yD'٣=GDڢGޢG~=h6=ڙ==+كAZ.~Wi yqh7t=2U>C6-D6kԷS dH{DٛSjTVe˃*-]@5-;'c k WkUʅ-4T KJavWϟr[,3I@C~/P *a(``dSw0\ClLM2Rh69i0,Uo90 ,C X,j`c d -xţNkV.P0r"7g`-|h J` 5pkp7+\.KsSU%(KIܟq~!?Ȓyo"}-YRZ'[N~/*QT|el'2i%Ne~X0%Dю+T!<'XIqOInꐽvdS8c2X,$)0 4tOZ^lD[l-~PKKK({K-gK!MCKCk?bDO[PP׆P3ENO*f ࣙ 3>ϕ#J\+,)y8k oDҁ AO)ɭp*(C90ˡ6ruD$R+;J5QtL6vJs]z\u\pd%? /rϓ844/i2oi4H-5Mna&&$L3LnY%&$BYgz,"#3w~!12WT8t &#K!H_NB ߬|uį&8W#pd͊9൅vEfuqMc7V)u["Uܿ/ϩ25 AVb ;P:T /j@ˁ99*0EC󈢡fTO %?[ܺij`?b(6(vIb7AY3߼$AV[یUz*vz_DmvcEs&3 i ֤!5}FlUNmgPYI;AHȻĠ؜0-4zyjL'cal-̘'ɸP37,r {h{j- u]s-D!xvWT$췎ծiMld!r6kcV+m`7+vwGq̞l(P kv>̆vۃ ꋝ, O-qKly{)^Eo)_(!ӆTRx@HunwkR\b0_R1L`[ZpN KZ's, &SPGB9e-Lrfm׽26l|m*>5}۞tc?W$[> ):#0Om/u%GMU E}-hWhCskN,aa0 cwt>GKfycn}|vZjǷR;~Z;neEF~]T?7~e2鵢ѵh':F[(3HGXE^gEK5f񇊼|]K~Q!}|t{s,TDy,Z}jpN:`|ޡHsQ1>/ʁkp_@iB;n nc[ރ[ Jn;[o&s[^rEto:pbd%U3u9B^UV?ԪU "`yUGغ_o^ŪTؾWEs8l赛U%: ;O" \Nkx%$ݷb2s~*fB~-/`eK /iv<b +^y iڹ_ }`.V@:c|5{iڹnK&11T-9ekmGۊr"ZZadBhسԭgMbeVɼXtk 7}JnfQ池pflsWpj-Zm?%ܞ %벗m/N9eƘ"=%P\*Iǁ~E~ |O]%ŒYScfRH$8ܵ XX񃱩$@sP[ 7%-/NO4V}5&=;RiEǮ<=Rݴ 3Kp zÉRo5LȐ4K ba#[+X3hplǺL*#EUrR 8Y}IlWail*TϿˊ]Rz[Z3rWG!7<ݥ\ZW-?ϵ[j!@{^T>M6ĈPgz&4w 7YsT׳2 z(6Qlfxh3yaO=߁Pcad)IPfMzg[A&`95BV[u5v)9{)HVM+|>5Ԙ[r}9b/ЬdwW!X+/&A@_}H{=R#٬US>Q'EuA:N[ !CuT {lO0[aEM T/%!>Bu!$υPمP_:(Ƞz#$>TATPkMwo<a"+4Ԏ&CDF}dR0$LlFIU574bTXq`L6TMӘ-ƅ%jV+>E}t (mЂ9~XilBr#4;Ƽm cP/Yk6x[#^!8Bl d˾7Ͷ}<5`Ԧ=`XA<=&sdyIT`ij&x*;P fpFgUr`*C}2(U? GFLUUom];P14ehG]_P>f +Q{D9?IŚΦ@*kw^qՒ6sjbZf)7Séup,:Aj2^/>G"2:S\aZ@_t7_u.طrXdGZ8P6}f *¥/[mlboKko.fhlnJ&վ`+ R7FYgdbU5} "ks>؎uiV?iG3kYNi\GdCɕp+Jª10GUo6p+>Z4ޯj(="CD7wX}og-B2"4ʁg3vK% 9NnN/6%l,$WҲku; Mu#i1[;I1r acԈ|3hkX3h>o`!AM\XVў,j9w_?rQ+/FM~;hJ@^1FU2y)UUi,[Lf# [}G6,hц k!N6ذva ˻ ks4oX1bd҇NL~ɉeުZ3uV>ϗ(W:tP:NytP?&tבa{ jeZ9Z9ϋ: NS݆6r̷:MXGBf יu^•`TΉ%b3kJ]& .Sp%{@\cv`‚@qٹU {:ʟV`rʡ[8bEep pJUYl:qn/ZĨ8$NJ4Pj=iöZJ6P0ZV>ڢϭAdci% Y5,[.hcl3~"5,fS˔PںpyU|9m`6{Z д&/M2z=h|ju0t106]k]o7D1=DH348y-S0'+ЖYִo+-`攁;HmtEsX u2m;+۬gBDȵnBPA@ ldLi@͸JP%JmCI/ cb4-1b䄌#!O6Ie±MbKL3Ύ1MI嫑Z)[(|tXB (hiģaYcO~ćw~-ޚ'@P.o5)U䱺N*ZJzOv;xΧ9< .^[sX ]:Fa"lraDq[AsȠ1f t1f(PPS]LGLd>d?d=d%'X9K%"|Ñ#đR5* 9 !I/8튨8R"mB&@'W7~δXtRu皪\S1f-\`i34rA͊&jR~-6{XTmކ;;mo}ڻ^F?wCk_ʒ- }h)NCR+t3ݤxzP;n/e9+(c0 ٭ָ%x5b",YE 㧧f#3Vw/+FgZ xݚ<7m$s*j·&@ow&'L4ql"Tpa7;jnTh8qpn{p b ڥF0VPP[R `M0ꁬ 2zNC{T֮86 `7;%;Hx<p'I ͜d I$i(e3}Y%_e7'!NgzOل$h'3j3j~d@uʄcJ yZ 0iQwYyJ6v.Q0o۰NB8\JbT1&nzU * *6嫰+O y }_sZ1b"fKZmo4hF8QR"D+WXIq`(YrG7[Yt/^#L@3Dd2"9g9{TXUIשՔBv&F(F,%41"ylrP%qx?_u_]'}I:,~9#xWEt_|  \ؿ8Էۀj/_^^5ķ\h2xPTN+C[D8STmZԺ=k;tM6OGMyCĨ~VjqUsoF>3>>6#Z;#z=2\3:͛!]oSzcJI9WKJpc{ca{Պyh_ΆcN#Κ$x)n=%:>JK3F~c@mP/6\ N1qi}]0sIJ(.!1hpz '`; ~у#t^>3g020YϢˡ[HI-e g|U#V<sX`AB"ʾAhBA"B?qCJ %Aiy& 5AB( ']oٺky^M_Krv+-`uRs zRKP2eܠ$h&t;O|)DaXنN"ڼc !xbLK5dKN>*Q:\oPi4TDh FnprȓMp4edc}W2TU"J=POSm3˦\[W98)Gm>1rm_krpќ!s3Oٟ)dXG<Kw (*I>Sȅ7DEܟ̣Xf;S1N7Nat9y;y׊`FHP̲+fR̲))bs{P0׋`A0G󦗯jy?S~KN<*i ֧$gāi kUvqEYVI+K'3ҪҟBl֋ jRAqB_evRZx گ)9hb%4bDZ}a,,3.3-L>͹4y(h:hg[ ^"hi3be-ӖcAK^,mx1o**ȕ*af`ܾjWbAss&K0#k%Vh0>>Qpzkˏ?^IpXflsN6ckҏb~Kb9c[c Nrbs-fLPzĉ?,p7r=Qt,"|%Mee/|B#1ɶ_O0糐' u̬)Pf6]a-h'm^cM pHkO$+? Zut9bwj0Z]ѷ2mԆOόZcqcP^Tuwwp(% T|D룖UfoҴpl鲬fKnKfKÉU[Zliem[/-W*7ܘqeJI~'U٨WlU٫*nKJIqhb29mf^X9#_gs!{`^[>nϣ4(eVE'1fGGq8~2? dCvkL7? sd49?ZEbT/xdp47?3H~8?C| uE1UuA~u2_[v1m=^ `A%,%ReHk̢:.*\?u[onscܹg !ïRB;3PCJb!{&Me WPMO7&e)՗`(ͿrG`/A9~LDzBC))ZC !?O"TWf72&(:4r~]-5GQ\OXZRCܰAMu4x 5k$'C %{i{w\rkPZˇAQK|ϚU9>l|IΡtׄҤq2tK(̌Y@]@[EPj3޹y!v%U(z\91בwPIdaS }""uAmX>Qqfvb`~+f9O/O_M72TEs]\!㵞pÑrHׅ2oB~kXIHɯCF='Ps6dw$@8IJJy BNNl2\;qI~'l55.4,ߴ^ Σ==x*s?xKV2ij`p1D?@38 EF3[`:̓BЯr'q R[ɰLٙUJXa8Z#>N!gˇ ݖ>x4]xEs@(X^Ξ%C0 98ٯm[rϴ_|94jkooޓpbN!B5%f5;B5 !Q)JNɪDJdkޗ~/x$uo*ź -2l-2EOWxq6* !ȭV'q2|ɁU6lOcBIvTv=oU(uE;L 4#E!0#!*PJ?U`MʤtuZZR#<94:O^l@[j-aJfv:à@N}!Fok}k60GIJXQ-Ԇz.g&ƫ ]i:K@?KJH'l)ZbtN=b瘍Zr\OsO / XGʮ5pFI%TʹYhfdmp*Bj\T2EClG"!ˀ_HJ}'~<ʨ6(ypYJIua>֘"vBIRi*S6bu:"~RZE$XDi٦ըt^t , r[TZ?tA4H \J`7 A.AҺӟfGTe^stpw馫I2)]睨k :!ZL?"bU1*K[`#\PO"$La 3TҮ_^W rޮ5p~ !OZ|a0p3q?t:Ŷ0~Aav攉IsmsFdA4MVemiUN5FҟYS>=O 575z횿le}#6mIF7\w¯ "DX$z?cϞ,ɗ`;>-۫LUFEKgXG@>btPZ.Au9[e,hfHfBM- /NÉV3Z6Z2$卿4םķuCf֒:ݤHD=t.Q\z+Q6R ٛZr_+Ʈs=3Dcyv,ks}? K{=D, *] H$WצHcάˆ9&C |":x(a)&<O.CP?%;"C"ڠA&"HC^$!"A2dJ2osAr)R@1й&0{நnkJST#SjQ"d}:X''yU@%3gn:;;9z:zA:A6oPxy`|,5 " @#B|' K397|( hbh EIxR?SՌ ̗c`u^]z{Tl:Ig -ͶEZ yHm&TUNt?fDywίUlJӽ=N?~օmL2 !ki6ѝG0]wŖ]ްq@н+ ەˆ)6XaZRP~k5ѤL;ovKanoZM+K `Wق6dDqFyl 2efa:cNi@s~lj窼h-BuK{vߴ1eņq*V2%|66ztfhiB±_אƺ 0lXٴ3cE(ߠ|_Ĩhkt*2 w] M>] Awqx(̩p+l0̥(؀_5d~PGc.yO (|ofxɓqiԆd<'pħ%G`'Xž ;`K.,?~TD UYEh3g@#nW%MPƺ6%'w ԫVw{ X?L<`LP+u}{JqmPwԷ3@P] k09ern9ޚr pH8\n[ |}4E#O/3K6/`ygs/9cewqgF:j%FJcl&Ox;o%i!j#ЫHZs-X+$ZAhfl{fz} mv/M_n]d u#@宾&2htOJ]=lGyy6 ߣvyyBE7];Ĉg YV<+!d}YvFځ(#dy5mL8CJ/߮~}=mq0I9B k}=$4Нpw- nRmҨݾU57~}9[&5z-t '!$}yt!d`EɛKQaYrTb)LnP4-,̙%or%o%o;[*?rbfC?2⤧䆺HR 'AdIʒY"0"J"K&o;hb7X'Xgʀ>9,=SgJ,PȆ.{k詻gSh#)@j:%c([Xɔ_u;Oa}.Ki_̱15uǥjqAAD [}} ņȩ3z]{5(y}19IUy{ Ow֯ΩM+ qӡ3x,v;(K}O"9Wp&)EU{j|ADW 𐪀kjh *#]4BM UcTI4 mW+ms#n.&N+NråjqI꺦&[H}61"k -T Fy/#h?J =T8kڦXn.L5[ז<x?hڃ_343ٖјAg@ BEd3&ϸrܳgz"N6ØP*c|6 孔kڸziz핰7 @ĕV_w<é718Ń'6jc؟Exe/ e{JT2T=FV `y5Mk4.3XPluKWX_,I[s(y+%jvO<˖_xB#k#sAy>Fe A&saPA,a[sT0:RHXL5l Vch~fZ7;U[͌)9n9xOzFJ|R&@h$Aޞ,Qž ^h9{@[76D.L@RsejVњPf,t;Ʒpܿؿrħ7aRvd1?cNG2!kUc|l*-cZn)JTɥ7hc϶>sY?Ú0F.X.Vxg(a(|vcZ4%v\fJ$Ozb|e ؃XӹUUb͞lcŨ-(X_xX#E,ܮ% M֡RfͰ4e V6hY!mkr~^rYRT&_qm>o=l}!Ub@?QJf#'-WK?֭{l=Znlܞ}"efy{wP/{t:d{ A E@cʉϘ F/Cx!r@`GW3c!Lz vD_f ?:tx/vNad'H,5T 8ٔ+k&HgwS]wË+eÛp:U(6sP@;i+YZ[&:)57 ~g,RS,_tf67Vz):R/х§D* 밥BF\|BG\WP_N[x !uZu+,/twVö?VcձşcSլyN!3]ӟKMw4m4o4 G [Lߦ@&AӽM/EhwkĖt7cM )nx5Gys$O);hmfvt,ҽmIcȲوHAvi<ަ ޚFΙ & ~wx>"d9mׂϋJbiXUqJa!65Pr@Q!0ؚ!+ve 1>2*:V^jy2s GCiC3b⒡&MCR N-Fw&kY|Orao%S!)G7+DDFZqA M 1EW9BEL1C>kRg'OɥAA5p_+QxQy/|Wy+@zY[OV@U 0>S[eg?feɯ8ewrKqblpvSb}\8d3̄|C0|C CFC35~|֑7xe3-gy7%y̾syMD%JuBؒ?pHhD]Dam(t@$ش|&027eE#@ey]YȾȮNϙߤشS-_*)H7s5uɒe5$c-RI2J)n 1a3ˀu~vM{@B#O7\ěST4ʿlLZ 4,e"!'[35(McYdnfasyt<|d*}m鲗X}mKU-p¹ J͒ʵKo>ޣWE*͍p{H ,е1oR2\Kp%4~*Z؜Gw738D*r|nGʛwrSO7VlPxtJ?hv.sܿؿO˻c<c`҄ M^H``\kAԫ^=3KTju9niX- {A)0x| ~Ao647J_+g,0jl u<F+oˬWmvq6']`{ԫZGGhK3,QUn89dqE+䘟CGC({JP Eʒ n\+m*5ko#q@$]K.yP##u0VCHϦC}6؁t%Մ-l6Mq bS0Xn,։%/vt9t 3#fU;bvOII.t؁F]@~  !We*kc@$<[{eim8ƙ_˜0R)!X,6)tf\5ނ R􀊿 j\ĞWfdY[&M657 +h2JDe51vCov=Ys)u F9pGj>XGN=]hHTAMœrQ.B SJ>YrJB7xz~gQ3.k]Z-G gY;+Ѳ*&^9uT.^p9 :U3"-MZʋuGiINZ㜬70DG/ 0U:n] k=$I2x3@ϦNi\B@  hX3~+0P[*cW+TSb1.7#1Μ|CY&ÿďLr]N ѣS09.h6S RnI4.zbj-/3B͗38wڛQUǑz>аܗI'&=@MҐtUWef,qfz@WWM૟oB.5Jcai9,~泸zhk~G5;ښߣ5Tz慤Fۙo!_]khiS#B5k\m]>r(cv"4d_dy0R@zq5#KF`#v B2m;}bLεB-m4;/+bI(l1j kkhȬ4!ED9=TKV~1Kfq}#on |."uEH?;"9x*5pa2Ġa \ )cߤTbܽ|z֠4+xS2<:"'Ogw5>epB(zuSˢb?_n,ON׬nv@u PZ[5 l(x4nnLѨ 0>v lhMY =w5 DN;զnlh!5#MukV$[Vɕ=G4с7(XXӊi*v+ڃamoaMz(\x Ig>$ e7Y.ά MU&cU X GerN")%D/3i:KȄKLm%XTX+;D]LR47eW 9߻Vه b|f+$Ƈ0Ydg^|7OOajEor &2=R%R}\e5):rsX̨ gu>oG&}ˁq?QT*x+%ݼdYfg@`R/dd=%g՚TC1 U] l&|Ʈ&ZQ"P h7n]G@xxgv7lbKeBH%<|n _qf9;W)(`sAK?l&O}V;k]12D Ǣ^TLAC;|ZJe5y3Nk>@\J&[acy֤@kk%XJmBګ{jCQ(y`Q3vB.XJB)o,&ZușcbE:_f&B{M,kk|j[0&vV}Xmw=K9971 6)Sdm?68!O9-}H5gLXk2- i#WN%90‰W7?Z * qTk{oI&]`n17eet 8?ǎ8-pU0c{U`uw thIi&Q򍵙L=p+si]A>dQ MT E'c p &yTWu[Y5߮S…K0(xu<5^[[_U|i&>Qk*<-J ;ZE s-A<^OD}ұzIpJq{>$n,I,VCuDn]Tq xub@KBO+˨>!ӽHoUQi͊F^ҺuYbaKcog~n˞zSxy׳ݳ߭: klʃΦ<;~r6agSlfw6lYfxEsܜb YV:u$ Y'dғݢ$5n}4P]KZ-thF7TTYcͽ#V:ܲ8&"5DS2AY,U!"v"SZL(8cՉz(yU2YR(~Wa!cHo:Te>98$W8~YQw9e!3tԕV 2z[7I)jSѴ#r™NsEah=t02 f{)TgTTg 7@WKn\9)t<ɢJ*wɖ``#wjuQl:!›L50z:eD3l:{ݢ{afĞˈZF웒󃱟EʊfikbBB@QMdm˨ ^+wMI0sLV PDk"* \Éئ3>%?tKGHT; vK0ma*0kb3x01[GY D$ޘ E%lΛP:|&1tU3[$&YpzTyІ 5豖FhV9) HEK K{|I[@2k:hK$,n#$aa)GEbЛ^ }fJYcÆ=Q&9ԷmdM◜s^>a8qd.l/xΦkHZ +Tӧ{|(mK~򠻝GV]YKcR6ciYJm%Pv ̂u=e+bT#kAtu%8N,K3p(Y,egU||O7P9ԡ#AG `^WҼ -駖fuLW"3ҸtX5.e)r<x3hIp℉d/Ef7 8L`j $ȢÔaG'f0.})n|SRb%  (Qauhmh')f2%HUQ'@K(5XkYl`՚nRNqG](ɭOѴuUu,$YqJSteuP= S62*d]{zQ "}#ӺMɣ6{v fh[?TE4 . .#sCdkM7 d2"2d(FuyZt Jc|nl2'=ŭ&mY\#0g`+ZC_*$~]o/On g\KӑW?.6,(4~cicaZvºpÙ#QO'ڏ^:gAGL򓘩DfLe)lj 5ǩrW%|=bO|?MZlpXl Op-VDZeVT4t\#w&}jĪhn D̦Ͼ1lTIa|3t+=[zpHqLGݯAva]h^tae@ G7 Оx4ƮjIa{#t1$@RSjU]`=IL'oAy|^Mu(ή$ C ii(*éaƈGI t T&@iOiRݖoM8R< BlPA.S7y,4q1q񍴘XXSZXob|ә\q1ΛXof`G 5u(R ٟDcB"܀3԰w$5F{6d2!/-۵.-9&VN>1h`4niͪkm9E+4og )߬;:͹ +ƱG bJ"j7|F2=`$ydPU@cZC#0o|D8l:IywUNF<`3@pl-9xX1 {Ws(϶XZaB{^9ߓvA|FlN CQ#7Zsb+喝D8-MP̓.CBkm)Yş"o7]zl|׶||׮}廷] ~ҘL{c1֘ƌo6fy1gc՗-M[K[ٕ(EcԕջP Jȳw\m$Fy.ӁP3Tv%‰=/F0%ǪދR/&œJ\s|qц 3g\JmHWA]"Ÿ'UJ-'Tn(S8j ollcŁ"JWwI]ꘚ^ fnpv1!4 wov+'Nv%O`yNo65No>qVt(wLi ӹ9<23 rӧD֐'8w|No\n\Mn:#K3ƽK?CӔ`fI좐l}51d0"Psu(um#3![]JrQ&M>`>jfh<8mSW-dIk]hɐAK+Q kUB%$>Q׵E8/@CA{>I$U>aʷ2I姓NR Rk2-.{Xtyf,N{_Ml+9: gd2qc#C^~"6ﬢiT%/UN Ɔt42쓷I}shzJO)ʼnFd,`dB_}!1CQ/4((CU!vε;5!b=_1w&qwVѢ =P+Ďg[NPW C y@6C,z/~sjtZ3[r>VaՇl2R;ރ#c_s[Fs7Eߏ쮗[ŤWpߒ7#|TߝK#TߥM;M^M0 sD  |ܩ#pFV!\+ګ; f],8J>] JAD9kmΉv, hg@xk*UVjK  ul ˻A3E‡| ˮ- +,Wـ8$Nq}Ԉ*I!e$-tqO2ȼIBp'N4(3 ^ʅw.Z]x6z,=pCGh3}c~ֵGYxUw ZD0nABeoAf*t)ᴅXNb%yrA5v`ϬJ3j):UԌb'o8YsyfaYIƙf+{w #&z?̷q܊R )-qJ@){euJƕaTwuvҸi${a\30?N[)aa?gÿbzClJ!irj?=k*^YL. ybJ3Pģ' -Whn_5+9?{BXD/MV#޽/!1@c"RG(G1& R{MJ)7bbm dpY=RT'Pi r`z͇bt[>mw|<רkSףuשz)iNfB*ʴwE0 Lf˝$MD+@(&)X\0imָdQC) txb^w\u[.>RN-YH&-m'zrŻ0?.uMB)8h<#DűH4HSiW2 lY+ܾJi7c0 ^(k-lRٮnz{_5Q̫yijg{/`hiGBkõa?X!쩋0mGs0EFK KA>m3 kF@8+o\q]q cV8v2QLqxLIj^Pulw?S6h; µ2#Oin$N3q;T5J.ʉ숛=V<}+Ҫ9SDTo~W>kI $VP EA‰%6-_[s} L%ؐٽ!U0 Z'tJz\i ^ZM}cOoyY Rgi}Ҳ-Gi6n=:U2 pcIKC's %>$zl@_%Cv1aK '}qUfwwkfB=ɭ] ƪs:; Yxr> \;O9.o2mVv`Ȅ/u:l[c_|r.+m6H^WƛQW[#gTˌ'[_|jz\ `QM]o*@:oF[HcF2l\wBZn)aB{\o͝QH;))U|N7YHNhN])U{dBF2ƽobc5nӎò OTA::gj׃Y f%.֖I^ ա+[UMO?iIp7rݱpQF>ˇnkVٌvtqeKHC d&#H?+?TTVi.yڬZ[>ʨ59wL]x;Kb$}3Kef)C [ҖnD)IdWp!"0ۖu"ʃ|0UW):`K]1dj AkFtF?L€'1pqS sҶ,_bBx:o=bi♾1k?ڛA< <'ѵ'>-",vu](۝ 3B~z,]G6ĎLU3i٭iF:(}U'o8Ysyf!w4E[Y)էa ߎ:!bf#GfqCsIZƢL+͠`#/]x8G8u`iy$N.jTσ*FZ9T7_I9537QB:iYot0&};&/ ~Z#`܊Y[Eb"aV`] S8wO dZO D 4O5ы &z+v+ݷ{{C@c(1p~bp"{!'teJ$q}^wgLsj]YVUg&3#Abq;w?@Sކ"{5-''z#z ŷkj|Z^ HDݶQd`m-Ȟ߱ 1V6h tą2[(DUmh'StMn(k;kzIk`Mmpr;N!rpʼnV`eEaQnh9n+UXoԹ4պ*K bAm}W,u?RuPۮSgWҗOZmf`)WH\'?T5׀:2|T@6 d!=Vu$'&EK-D Ɍ-&^?kdC6(Ҋ+9蟈bsjo"geF^&21`5y/6Cw;+#]&`Z}|G?hQϓ4Z^:*/{kܹ>A:!IbF{FU(;QޕN*nk!&i~:;a9UHm|/֖Y,+j" #gZGi+R2΁LWJq嘡znN)М`y* w鐢yYe Lw=}fUk5S@~'~O}r{А.#R1R΂&>@A T:]qUeyxR:Y`23@[i{HY0Y'T2ɸ8y 62Spz/.OJ 40ZUI'1h#͍-IO.dc#XSśT rfu9&U闯5ZfE22M"5?gܣֹ?L'S1쾣S-<ն&6 c3ƩM nuSLu#2z<ãi qM[ ;%H /WuR|WTnjyЮZu(p=c%Lu!NSz_*[N(^76YyF5Q՛T0/Kyo_n)TWDz$wwU#Dw/h=Z_G:zvllPZ_f^ harc$B;k$'ZWT|09Gės/-3e8Nedh\έXRgojFHS=T0i,[89a2(g~OIlࠬIemW%]g#@<%Ĝ#Rfk-fAcqձߊY Z0KvEsfz_^DƊFt#3,>_Q~Vv\=뤐Q>(mhk}/OjWT*/U^wx1Oy^;/{^obzŴ;bF*Y5ڼE%P^FПli.E"8@uܾ:8 cWGsq:Nj,]aaXQ''Xԟi 9lR/nrS9gcJ2,e9={:sIg.2N C&eek&V-PSϤ0 -'*V5m5q gg 5MD|j2tFRR dYOs4a9 F)IHzAU0 X2ڮz1 '%U!.6)ђ9jɨ <+Jf]H`e}6!%JD&̱f@W+>@Շנ-EGN*JM#&j5tL>RSiUTr IF'MK-t 7(p?:VJl!ҙi'Jucq,Y[~LofE Ma)h(( oa'#6,_B c_~Uu']=^/7934vŸ4O8?~⠡X&X {X ;:NvA`a՟؞9mdԋ 3ҭ"`G6dkt?%q88w@ky ŪIPgwk: 1kLad,(a'o.ik^ h^P;̀Ѷi,[c0tbyZ?:[EяfEi'RcZ|۴(;--Fi&-Ƌ.^=(1=3ʛԘK4h'x:_WMHFLmKMė *+sRF_.&%4j3wTA Ey dh9+On+Q*NO6wŷk O.\,zTU;kVEհ לHPXakIӾQvYG}&vFzrQ`1[:ptBn=Jk8/Д~?"Z=a{ Oyɷg΍YF/m-ьR|'&HҋKcpg'hb\Pqam\o=h}791Bc;DxV}ʃo8F)iC۱nQqb ږ⼍r;4/O'^gfW >od|cLqZZeZ+9rާ4Q;y/|%գLHW$:x:17zdE«ޜ, {ClHz{5*s >\\ZG[ ch1<kEۍc;唓PC'69XW:%gDr 4D|8n 4i^?F8OL]4zC$1-HEd@տh#:#LDh-@Y+VS\t^]o&8hϔf{pZ˚:}ٽ 5[[k<_x<IpFfQ]5Y8U[uӥcJW^CQYz\`q}7y>G&Ơڷg˄X XXZjT%e~=WC|wUecUfz"A3֮(9s ;O"6Wcm,XŇOB#o&K r1MzMuZakIt'0)3.NGB l|ؤ}Mk&oL1if]7Y4jxN*_ J5g>zTd?]|1#.Nym`=KMt7ƌ.iu]%O17ؘ2[S9b. \ʨUمH3;E zy}z!:9P+ 1-sSMݞfIΥBut'L_w55å1dNiMzn-DɢKQuͅ(\Ej;r0aV!i c}afR] K;&V~qߒ֡C4Q]PL$ڔebbg!!&cUK{#Rׁuۀ +pq|9v, 9kˊOzB]>- +3%("l5\ U(\E,Bgc<)^КBG63Uikȣڤ/k0B,%V _P_mfE>@$ ѻrŠᭇP#_xJM}{ώae1p>zYH|!V`]=] w'4vF:XN߶3/uȉq?C7.;85o=TQ9#k`hPtJ[Ph ?Fts!C4΋aT2CȤ0K)a;Vs\1`[0a:~Cc,|uEw:x.E6wN::avgϲFXҏb\nIK-_$7`n?glكgCl4ʽŗ^@ _Ka"5rIhnCDɸ&-ntJdpn՟5PG[ ChHU/hM]/1'Ƙz-?gKsmms-z넿\CZ~g{k+yVq#7Uر} ^(Wp&YICVhT 2$LXj2׮*n+bGppv&Qm@[G$/AncYdIya*kV\0aPɬ`4nj2/{!#"r$7:cPRG.PzgS|N;ӉisO|N=z+|7:.ds̒@yuWǀvYmR%=Y#o>'' zfT x)/jȤ&ͶFW,%:{ S&iS6@"} ~@)PaX@4 G6ing7&֕ϣ+M?fXU5z.:3KCAӁQyիB:oNd9:\>e7ڱi6. 9+VeXKL6)Q&$ ԁ⸀“t# Y1g2C2NE#2[Emd|Ê/6J.ίkb)=a#OJJe?I"+8 pau!P2MFц OGjmp94tf j*_$Q5\?*'Zh`KQUu@q;VaM0_&543ؗQ~*^ ml4R%ߏR{9U>% :qe .C*a9)洇-]8$yܞ$:Db`gF?L'9Ti*0cJM.j.E]6Lwrm2&%Qm}ǁ-gS"&iXJYw8qKADJ@*zɿ0{7@'ZrEr 8 $oy >B)?/#ɏ?7sRj_r &LwäE-MS,7Y,%Ǟ%9Kwdɒyϒ%)JS,ɜl@pĭZ-ܕ 3ȘShp|O-4Oٍc #A*虠 5Ӗ-Ձ>k|Gus-6ZN 0C\7g'ϸ4=GC\5#w =>n4rƖ`1,!pWQE_pR*8TTdcE9 fa/Po?\{-Nw02QDsPq^9XV?mG{/F-=GR;kf"hC['&i()}ԆЭ00AWmRZ!s5(7VB].-0QDa}ɹJ.rw?p'^0jNۤ23k7˸̔aN8ѭNPŵb2P_+#k2{{\EvVU:DqؙbtM.ya-ϊ9ڝ+b lIqBR }>Vz.u>ê+}4_NzTö]diUP2! tÖkw;߂|$cv>_񧂀w~Hsx4i5p?n_u_uoA WǓZL-o'cدn_dñ:81!L0e2aL41;2C'Z&x0MDoCy/͜- @چ󜾼њq}vvxΓu|ŰVV_kհV_kyX+չ ]\7q-}5kSA(CG,AP-7@sܙ[d٢6[ahbDsw$'緩5Oj5Tfy~G+3Ͱ k@-]r,1#ktc\'`si}p'>7n6c R6$?!Śa1hZ 3t{:k^˽%/mH)RY%8B}yK`Mn4]rȕ͔5dwѲ5h`jfEv dgʂO|`M`:/g:ן9 &q)#~ӗUbYzi:ovR3p%uof.Z4upG(p$v0JbD”'W( 01u*H1<m㨘C{Bg =YW]x*:5LΫ<1+-vj]w\uŗ@=4Y#xD.땦ܤ~Xa qױu&%?cYrymN2<>u;.}}'Ub)l(48Gd8nb@eu8Vb1'v|fy"Dڝ`" ,l1tYƓS/Ź2g]Zy Z|wxB\m+RT-nq4ƞ7N,v6SGTKnyrš(hx6Y׳E+Kajۅ.>XaMn*ºzAWFWNWU4* k9šKX5uS_B:Q0*bFUia&&9Eh ;<++NHCݓ sCn}Iqi~YZǙ'?<+g};m %ST,~S4/U%PV9~k{y_(vZglm]Mlݟ/_FqCҍnN+ J+sTQuUUu8*$IA$Z_#N<A:&3بϓ{/'(Z ^9Sj,}z M) ȫqffE0mjo|Gu]Z| $M֌<)cR+7ٹf;Sb0Z]seVn1DI۵AToP MkMWu*csd8t5̡FcK#EsV]\kO쾓dpI)[]Nq  .pX{%|Ϟ'"stys *3ld_tX)uCϷNFsm$n?qatZ5"J|/U)^)qqaL0dž1|3 (ռL#^pRLkhCbvysi%Z48J~WL3[ʳPO U U?8󑳔eޝeߝeݜeAβ8z,,sg)sYK-띷72}\2<􃟇7;VSI)I7SO6@?ڦk HL?-B 60ᶴ]qA?*qA,ӛ"OO)=J,tTh XYCy槒_FأaBb'V䤨$@IRhtT{Fۓt.5Y1E\>MldDxH9 endstream endobj 164 0 obj << /Filter [/FlateDecode] /Length 48128 >> stream HW[k Ux6$RrYC##Ţt|l7H4pj(>V[\z\mL`ryR b*Xoަ^"U2Va9rI̙cܵrI {Kj}d6 D)F8p7~b ri0}U/;'nf{m6vnIzD}wPEC7:w㥴AbqZ!M1g֦ux>a@pu#L| +wzQM@mB!*|stL.$CWOp_`DSԏ+>0MOrSNK/H Aw>F[VkcB,-!wkQz T!bQ~tqtOP6Д;U9= R{Yh^ᒭ>趨rP|j;u"LxLnTXƽu?jCu ٳOF}3ӥ %u=.a WiHA3(1'ؚޕnD~BCn< =yTZXf?强^uL [-W>۰PI8Ma5_ط`5?VZT(UЃ!"w㝪A_±ؓ4x|U@(?pag"!1'=g% n;8+yV]z^}6@QG5g wӨ2{П!1 rX @@>SyhOVת8x~ rT"DP֒ˆ. Ѿ 61zc6d)㔶lᰞS\K0MR{vȄsH>SMA}DOZO[YU W{j~5DR ?!6?tw5wlls 3͌}NgN) V.%:G`u(B- 7cnXDah-Ʉ? ]R'CBl },lGE$t7Q v67te0PVeaܱv"phsL(B Y*xGD ~-lr67Z̘nNv">wm~=7=fZoc!e8b52{,);L>C.Ä/9z{Ԅ5Ag5!t'-YRfBɲH'DfG!SrÁln0XrScŋ9"͖d`d2z~fptaV7r.Ϙڏ1TDHJ5/cSЬA3Xմ|`B]ppMCUX'Y )rk )I]v:3uZ,̒sf6%)` HJڍa1I2z6A!WoǸz?޶=rquC]/^7l+iXm?M,}8/%n`<)1vs("k^mמ R\Ɔ<64Of,B}$һ#Z{ِ`a~d'M'[O+WP\&![5rHVsST*o8oxJ:G6+LI+v4] lmϘ'L]W0u6Sߔo=2/Z0oYyaLmOLg9g% G;9\)5BCq{d -%r=ric?Ӈ-#8GePʺ4*ӯ5rƱ&>哭1x@ɪK"0iD,%{o mb KqpđfRjx?%q\2y08߼/ h60xjjrdpff̱)aH8_MAYqi] ՚(S~"gRɻf$EN-=֚9 rYFk%ɗ,s E2c83\lL8\( Nv7ۘM>)Thܚ1uX *yjzYoI:}#X&9@eI,j?cA']O,s?kz2Ńv|qпد,7rxyofvbJrSFL2I_&T3e>sFЖ~{ݑ9NB}5tMib,=zRe.7=1ro 7cdRأRDmk>!mV}]bm 5||ϥBV}6J4g3K*L>)f5BF(Ų],WL4{Y\\ˊA#],HYU~ZD^ -rGwF7X3C]*rMg+m⦻CioVvf. u)xV4X _C:*Khe#b 'td/@Z=V+5%.[9)Vѵ\af%5ogTi;:Y dD fBd>3a.xdP{DJJzPKg\c s\Z-RE&g pJOw0d7k*>kMFBb'cȔE:c7Ug0"{ԹҳLdw,'#;`M#ۄ64Uз׭Q\י/U ğa獽Mq톲qVT^dRB89'pi zX^fcxCaM/>ICgwE!hbȰVݎDIǸG<YqBƐM({'IZ1ˆ݀r#:rFb@B3IIYk  Jv`/%l] Z 虱yA`SMnj9y5ψRRz xTYUZ:Y&"ٷt(X.T Zu"PllNSz*qɞ e'MDH3l(\׊٥,j0wib Zbufk4{݃Wv54ťXo̎vJ+0l3gS+)|cˌ& 0(1 Z}bK%VϴpS6Љ˭b-ƶi }Fa* y! o3 .F/:3irs-pD $b3{'hXtIǒɘĥ2r6ݳ!wf"Gn>K`moಱԠϠ4L.ef I>4$!)I,w."زu ,G6R.` ѯ 4ɤ+$vfa)jLkxjdI4>l?2f+wV<ӫDG&b< 9 E<-*3M7[ؐ0Wpڊ_bCaCņ_eCswF\lH?CT-5ޏȋS뇅"mh0 M݌fiyD)TPbˈIE?R_ P*R1KEKEJ>żŇ:1Nd>ߨΟSKnbo/v[Wk>M+i+Wa)9?%%_^^-a ü2Z |gF_Oavo8o8.p0 W> &saUM(/n"3R C n4: {a h6sH) )|]/2SFmZ#2"9PSl.Fܙ` % ~Cb,p͵HQm|N͖Yh 1h6=Fo4=kpEMQW5;ʫ2/fIseYU)fuI7t0A ~Lc[)`VZ@OciQ؈fGģ@&m\nz:q}2KZmcgGYgoNe8jZ3Eڳ qHnV_#,ݦL*bela#q[6M_ZnsEv- YDAj~1 ?s.ƌ^s'3IyOwR^t''y~fۜdc^I͉/gF51NhF5"uX5"5-C%ڃJJȇ21L(kZ_*tQ.a+죦viQˡoIKh5VTur\,S[7* F4P0sC.U)AUpyhs*ӌYD[S70>RY'kFnm6/e4uرO?PାBȡ\qa5ع'ewP˙]%*Fء%වYu:&fH sAmqANY@WAbº5@6,wZo4كXQ* շ8opiha$I a_ClE?L;ERfd&wVf_RlVD59g'qC3ptPgE'Q =Zچzg?6tpYmhey7]n ]˻|yTg7333NHٮ9~HWGŒsΛ͘GCРFg"dS`sk9mrX:"_yVRs؋7뮠zW[aAY Z-TcZO8K~ n.J_tI0&m Ytum_w% %YK/PuY1Ǻ!t{2ao2<6<9_jOl[v1Mwg$;~d#Hvi%;';X`i Ξ)^lNM:(`աDjX\Pٱ2e)-{>1#n`Ε&)Eɳ56ZZJh0pd`9hD$ e<]Ѹ7(v94Jd-+ TUMGݏ5#=N4! EYwsj,⢗+oτۓۿ ϰ;Ó~~xQGNHp顨  pRJi4.ix;r _$K~m^\'<^ k?Ǖj~>ޟ/Pkո'PF=$Er//,ۮ?gc QJŭER{m$s`͘NZ39/,?_6<>9\et|؟Pɒx4)b)"i`afٗatE֕JCA!hx{EdI؊#Tm 8| Z3-56|^U.j8\ )^ESw\ue-A3ѕA~sr]cEF0x5 ~ Z r~݆v)n싯Tu ca M l!Tv~\s$7fQet>'7Y.(v͈W+Xg^YcI]WFcZOҬ:].Hhn8[_pL"-Aۚ2N Z$:(%]nz!S tûPK1Yhk'sFE @=A -$JQTbV r7~.fD~7)7\R]H!e?jB{VZP6@i{Y$$ԌR[aʓyp _@vP27h%{Hhiܡ}aR\'$[׳$y~ɀǶqV{D[4418UڂN%`:-(Bg|~uc9O'N*flNBSPLv]@JP|_ݶEKO]:Yۿže萌d#?|[,2Jn}S&v>X;z3WzkaSkhvQl`I5W6c: Pױj8hxDA tj[S'pczTEn {%2>\&Y5V6l ,aEP{/S#I>pNUӥ'cko2*|:DLpPI1l")#-kOF7Kqzctzd,{buzkI]~/گ39*bEdPೱˡH%}7$%SF!~Z*/pwI+`Z$N0;'ߔNl Sy1̸Pj9Lo{EQq|Xpa"Nq'OHV/,SkbȌ8|CKC*t#g_!g'zч>*?*P.hl-0Spz8 !1!)o}ׂw|x q>FuH#`گ ꒑h6sTCjV_g~r ̓#0 1Պp7,0> ^{ bD0yG{6ۭ}y ><|ݹ_q.ݹs=S>~ߙw}{sss5p7񌻏>kӳ}8~ دIr#vWT#d23s1lx1ةLIQ mp!dV0^M X-LAgV2Zzٔ#f ŎseC,&hE#~ KA){pP 8z"3L!*UU; h(qgǴryv.Ɩ#nH:yϡbW%J}na&TZ,٘y!yDD)$x, H&0.i$ҕ%b"0;޹_Q僚3à!be&66 Zֳ̲ďdx&7M48&Kb p64&@*HNy$P.4sQ?F9\vVI_FhJ }{Ol+6x9(rA{> Ev>DL|sZf(9>.i 8af^7Hv|`y u uSUE܉Ikě$Mmjg:Eq7l5_ qL%Z/YpJffX ֠NOO֨9ŘUny3PہeMR`h zW ,H>]zYӔjlA  ʮ6'TFfE$Z\V݂1 ejelq-6PC[nqN$dI-Svhu]ѱGX[\M2<"ET{c^vYR.;CKbH#uƼ+>5>eV.#VÁ)N $0-Qbf̕vH0ka[,f[1SXpM45lԺ]x K`*Jsİʊ>cH#$ARd ѰUi!rXU{W-Yu dЦ[rX0P2] Q·$NR!fR湟eke5N:I-& K M 2YXOYs/1\pU&nLHp)YЮp.3r6 yL qB#L_ͼb%5s`W V=z _|{x=-wA{(zn." )4Aal)/0PqC*2&NM) u^mY"2ZFbE+.l+>,u^a٪\2NuՍrqJ/lcp!NpkeN?gډQ?+] ][&4*:E"17 wHR`3K:Uc;t@Db]r-z|%yW+@*ά@~LA> wlT58V{|7>}/m?mA䟐֮86H3a[jES*M}+?_sXY@ǭ"gTP* [X!! 4֍@ECԬlx9Ů!Ѿ5D 4D(\DkD KVS/37 o{2n_~-3hIS8=4]-K~G;-_!x|?BhA 8y (~=v))є؍YߌP!lJ] l=52_NzYSoIkx ;jXѮb}eϡ[u7 aGZ|ɂt|Q#,jgc] X6a +24S%θ!uL3 EWVN꿐DlW1mZ!s2-;J̗&kH84s)*6V\@ ;DHJͰ맒[n;$wߑ^[auZ-jv28-Ug/ؾʣY )r%+*ݡ1'8) ^->/YAbA30* 8ixwc95.\~p J#_/>;.J%Lyth>J;,Nx{9(j)" GqNyz~Y ):*Op@oGEM H#&$jQ'UM0r!& 2Y8eeň]9a\%sZ󛅵36Z>&;}h /!kb$yp.^/d=EQVC14L" :ٌrL 7-o%mbWvH; ,@4@{vA*-4^M{err^^{v{畿Lz|Z x=!U9:PhI6|[|4d# I(*oc3Bx%V,d^VE [c$nDnAfvPP-&VS\:/'7+dK;դq+*w%K M4:;>Kbt,I$NP:?H$<J @vtUZP$kzQN.JndޤIn_u6톔*vPiy DCk"" mhX]SYȫ#N' ft:hG4$y Qj F}hRD4Ђx`x p%P8:(htE? CW9Z"m/khӢɟ??Sy!dD_ -Vd'[z3XKZI7IΤ9/q)`G@<(>Q"mE&t@Qρ2Pl8t8xZ"H yjȂ-Ew )/ t:|gU5FLY%gT)OjT`vKI5$]q|gWL:IJ~ݒ[ZG&BÞt ). ڷ*Q)[+l9# ~b*{gC` 谺g6Ɖf øfd QX9uF?_ڵ@|>SUp6Q]ƝIn U2N`yBUwhve_xtPR:ya(?b<]~qŪY_VYJB:ҼQ$[Abi߾ig }B9ƝoƍoƷ)ƍpNp+7ƍהrnzs9AIafuω5sX4E[4j<č$loj,D' '[/ cձAHY8-nh|k^ܟQmއm#}!8{~f:oc^F {Wk*˸.著5b3\"7~iϪ(UW_c6'VګБդ9׊KXաMs]4XAc<ʔgHB "daO:e[T%՟qB S1%[_):%cq Onz<qQid($tj@ 6MޯB:֔fF h薋3+Q Q(޷[G-ߒ+Tٲ1{Hm Q(qA3 GҌHxLs _ڵ`/`ePUV_r(6 R $2 c[ uYQQNL6=ㅡ`Ny̵{Ɏ9 l4)V{$# 'eRd[AõfOmʅUO@dZkdUZxe2oWt>#(p_fa"2Ě } WN'L7ga9W;D^XXX"kg#y|9ԁXftJ6Jj1&l|U!̈́Qki1ϫGsY2?SO^?43viC|Ӌ.?..n.7]~}.?.yϟW>?~2 *Z]y[gÈSғ7yӟ*>?jװKV:w]K $E o zWLU@^OAXh&mAD"E$ݝމ% ,(AX6|p ݵGpH KR|[B P'[._H,I@ͺbie*i䎱jّ#ǁ @5~|{/eDAxÀ[QTR|MXT3}|!T {\vzxjd@w.<>#/R/4+KP*rm=pFT3L퐅,t3[M6xz0 iMhU7FUS2OeaMχ=Ϛo-ݟD򢽖em;z`ي1-Ϥ{39%}w5 $_F9ݫ B$1Vy|F4̼ԍZW,c2g;VcK7d'j/IzrAku&Yҙ|]ZWþ j-íY(8uu8UNlGŜ֘qCPLVs/PrF\c8Z/N/{ 2]* ci;@cYoTdco2QMwfqpNnd(&ErKJGqշ?"%,uF.ʗJ1=rM%- F.;Koi‰tuSuMT/[{\]w^tF.^!$-RkWr|ݡiw[lC?nn82Lc?j+Js@W +W}e{W\z*ۓ\OM?d*kYe*Kb4~N(]ʬ4% [M3:|"UP ZD^\yǘ+ctı*Q4CѽDF_[J`+V | w'mΉu|24TXEf%]qKfJ9unwWvx0v-c7DgD[Ɂ6K1QVxiN笕;x9>q }L:J})P9@-b)MOj4RhR ȢnB$eF(5&(̕&7j,wȤ/)T8AFXn=@nhg A7SRw?Gmȉ >* kWlfzX\ӌ;t8BB2hu/ȩY!?!gE3KdcmLڢů!SVVZ:Xv j˰*ʘEfӞI:ʷ pVo|oe% -~G>Эs3vn!;˕F̘Sx6m ;"UXVW΋$- k3(\T}6+P)TU 6`ŤTN"+.UYH;3^'$zK]̢J 18=KH`GBb$P.a |@MZ",iunKY+,o #\#6ڜg A֌R}r.=};o~{ I;-* {ۭ5å<0M+2۴`(8V.!C8NE"I V>`[M˕' Rp9BۙJBʳ]`?d]xqطIf[=0cJX.}H芄Qki'wFM}PY2vv텖Qtd]["Eete4 rų_",UyYit^\lOܖٺYmY򎇭~7Ya/h 3r \В-Ÿ(0;vILeujf,>G8,,c w! T`yz1{ZKi K ϥ9J=ul4Imgެiw_+кj 6;S¸U8gy .l c, f1١e|ZJ98 ;j՛\P|zgd1O%i'yoî8eģafㄒw_EP}SH֙ŽND'SzhǙn@ gJ8W鈡hZbOSYG":6_S5/K[Z\X eklxFp )>{et +Wke䓄 T# O7JC[Cv8'v&pf; U{\c-!5X \#0d>f H+x6zk~53K vFf#z_Uc^jP 2 ;Dְ93<5nhըM"Ҩ1Xv^ly. PȡqW] WY =5k^prgT'TqSa_oҩKͿ)+JmmR~/'?N~ɯ&?/ORwڽJWU+Y{y4-J+KK`mtԆC> {2ZʰMXZ:j"5<|S?f ᯁt,"tb[}q5d7dJnx,c)|)GN5krw;yuvi9.%+sF+'z/dr(\حKmQo,hhĖi).DʥRNMtQGu5u.Zit6ޠZr'5D$ȘNT涺e?@nf3H2ȝ(A_%P1y3 ȕ+̅720΍2ӌV)-,}xCts>(g4,ڱ[@+&V'W!eXYx)g|@X$ˆMNן!_EeԶpb HSErt Zf ZiUc=2a8RB 6WV[E$|)ŭ57W ߬c =Mxqd?'fnDE GO>-Hr8vd!n\$U`_iؼu dMRg,uҀsOkYA8&1dѾQfNx&>n rM_>KV,~\^1F:"\Lj%cNM&"ӚŴ`I ܨv9x[_ob4kiҜ;GZ=@1VFէ1[eA6ew|͆f# %|{\%VO`htw''ޱHe-0?:aG2ǣo'jS19U*gZTT,d C)%({5 gsx2!yl,tShUaQrxڏVa gGE!;m!^A_V ȱ)&s>>mhP~':Ե>h?S]O+m>v_U8>)-Ž4"i!]eVj+aeCPt"MCf@YmFZCEtd{y?K[b}/i=L([M3i(kOj ͜TOѻ7h -im!Jl^ӊE}sO@ 0WF5v s23rt;ؼRךkY{ZOEJFhݒh%g\]z@2Br5}VFhݻX@nFQi뫉M*,M͈v^wt1WXCҝ8 $ꎹ oi{e\K4VKU뽄%T kBPy-JB H%mg)a%ktKK YϾ^}i}/orr_*48֛_گT_rRqrr/=ǥ[uXU )B;\|Ņ /9. zq! /qu!.DBڋ.D*e&\nm\\,i .i ~/m.mw=A6]~6fnrY2<h{(.=K?'p oJh.N37@YQ%Lh^E؍{v_]-c짛bc4(p *I$Gby>4=e=ե%%g1ex+jv!NC3H*Ǯ$1t5YV!7y&MR B Y亘g5ˎ_+K,@~R. [$'Ue4lﵽq4s" IIhmՎCoaNT҈~a`H-Uph[sحځYa6ܪɵմI1cx{Fp'f<ǾH7hk㨁eӷ hhUW>u[ѵqQyՃ/$ yHBHilwSB-#\J]*WS37o07."u`ܞ7YL[`cmĈUd'`oMP,Jlf}A%ξ1!*7vyr{lt/3Ori8GF/M* wú@\{lK"o_:>@rƒ9T^i3􇋝Plc[]<蓸NEOikpCjC0؟DA.P"вKAeo ~Bxv#f% Z8Rݣ3u jzQ9ԅgjWX'S\VNٍ2j/?kNHo}壱Jy\l<&K2 K$~cN55V[ژCB+S|?*/IFUP,GyjΙ:,іeC\ Ǭeim]C?IR1%K460IJ2^}|&-ku#|mӐAKϲF6=ܿ%=^LQ!Ryac6R^,E˙5d;RPq-FҤPB;O9J]uq(sS~kEHdjU֣٩p`NYcOD"䤙0©Wس=us _K/_jf!nt2A| | ~}EcNO9<&q NQ[D?wheco嘁 \jxeT|OH:ZwdBGk"]%۪;il`OvLnC,tӂL4 jɄ^9YV,' ĦuVDKN 9JܠsUkfdC𮴿ا!9 }f|P+s&'w$$tv5rثVJUbPDo yd37bTw7fHHDSDd\ԥkS\%)X!ڞ(~VڒZ(W;0d)AQWX.}㽨sɑ7OXDSh;R`!_"j gQ F.y4'Ǣ7W\y~v6` Vy4zf%jOt,N4K>kpYnLUi(Ua͍Ty):Sz ˿fL篜wsRܥU2="EJ3trJ]4XHu'րĽ9FgΦk1OY,F"hcf4X_7>PrgBx=ippZhm;v@&& E} ŒC!~a/f7`Wx3ozP^+aF/L<9['g~ ^^֟/]bZl9C]k` : zfll`I4q^oMsJ]naZU/ ٯCyᗫ, \eqκRz]y Gj͊|ï!f"'XNNx c{VJu;6Y (@Tj[dJzߢvMj̼eIjo>h.t15C0Kiw[J65,iuUIH!!?Hm=OZ -o@qH[G;[w~ EtRܠ;a:8pNj%)_R]j_rW]j.cT޻<k@} JŇנ%zͰ:JtZ%!lۛ9P%患RxF͂3n=ŁCihZZCH^9%xօ"j #q__rBIV2°yT4"v(_ ~CmPkRE$D87D*\- ogvaP3/qpAS|m`[/Bނ-JWAυ:o ^6f>l VhoB(hy'#lU(7'EIieU?$^[;2DfY3'2jYjRjFj VbYx,E%@oL'oKezu5ək2\r68A(Fc-WB:!0CO25;߽̀ЁI7 5p xJOʀJitՐDD#P|8HcW;6M? S"fWr &^izq7S M/zGG+w%( Q< lqs0e*@ ={7 6d-u+I^x-6sf~A:o#G("YUAY" HE2C@u@j;dz0X7ԈSop ^EFs_cS %%T\-Փe mpk8Q7mSUæJW/1~T.l-X3_PÖobL#PUu=>ڢK"&m*6s @& :.tMLJ%${Z[&T;^7'.j1tȜL aKq(F_;t6OV =yeS95ʨ;n%jB>de~L\;,M_TQ4* c c<ƸF716W5h<}NA^/ t؉ q14ղAB&3-( Շ(;l5ȥD)QPd=iVI{Guh]/e*z. bf <rRvYy+.WԟHH^*J`K]ӚILjUcd+hdUMs϶QfLYJVAHk[ $K@LhDTy\EP;]}_ =bm?55ǎHgiu]CqFsi5HRQ3 d4>:`U` `2y]ѹSNx]~cWa b/OO.`-F* lJCyHhYְ' 6oܤQas`j5?/@iڶ5 0nmiJ3jl8څ,6yVm]>`q(d&&:zxLU7bG <0sC0)h R-AnfokVCfS3}^t"@gB)ޘ8 foJ]ٿF=5D.i2_-$hƬ{MVl/ދR(1z񭰥=VUɧY 1j S1AF_YXJ8~[b&)8$S`IғּBH3[ʤ:g5F GQ 5i(|J::4ˎk|} (F[9tAk?@v?Wˎ, +z{ b/"zHʹ9Ue˶DR[1]쒱Ai9E*UgtwdS a}֨VZcL,uf !êG[ԐRV?c ^B$<kF'B^Tīזdopvlf&.N&}Ssִ]df0Ï7'd?i}exvx-G?W.2zQ2e0cLRu *Nh_)\>Mq}xq_?g/<&4V`y5nnmPryou^Pyb'/ 6@)hJЯjh[S4e iO3(e&ʚW6fE>6)0XѝhdU5--Y3Py7AD~lbGȴ߹pu[#aQ` )h2~?MIdd^)}f:TR:d ]ɑSUJVxf O0>}˄ [5^V%ԷjJ S>ܪ%I I.5 Rj˺GRIa6.7IQ&#"C dP,Og 0R7O/y*~ʹdT؈+9qMWW<36> sւbXUdβ倶P WЄmxO1g&9gNЎO1+{/6 0NٹUu%heL(Y*%pPԝ @$,1Fd Oqʜ#'L,jcsZLS<}lk>EOlo[Ó/Wxq_K>- iԉ R8"+)OBacX(LP =D\?k3fAf",/<ƓE"tjsh|ͺUAj8#Hiŕ~Shyg$>2g>.k=w޼plC*$I|g^+%/ p51|t7%vQ?YTVWɷYh@`.Jeö\p%ϢaŨYbΧXLtl#-63t ~P=YsVR>nd1M5zFSs`ݰ(]%.ܼ.j2OBTJmj=V@ mVlJyV>ur@\yJLWؙ#QuMж' ;w6N^h3˖VTiZט̢C 7iXQ,sS u <q[:w#zʔOV|r@{ۍJ5'8@Nmz* Ay.pfiW &S]0Wc7hV_yǓYTZC& ?&ګkVF8^s&AIF0i1v?O@O2/Zw ٯ"Eʙ*tW>]Et׺l1?_@ ۑ=pp8.t.<9s܁ x2>LnYHf̑?B!-@ݟƦȭɎ&v&%7uޱ`[)sJL V&=^4eԔ=(j\}"'@^l><u{,>Gcv ~;R`קݏ3`vz4s FJZ[Fwt]Kgu֋mIE pf,<2Jm-{R~[ޠK3{ephՑY((S5lƪ;cI䰟AVMS(+0'}&d%%mӲ{B_X촂4tV>vd^#]%֞6Opsk5N.U-^Kw:-@-Yo:ks(W僁2[1ܟűK/~9!أzP%:09nE_U]a:Th0ӹI4E] "/aIonԸ #FʧV1ÑAڀ:<,owUh}+aژG㱦6-28\_0;E5YgTR)vR6ղm|;N0\^}8Ydj ݎ*Ǖ `sp$,/5+q0-2y֮vTuv@8IᓭWdzي̚idZ̺]hhigVWȥef^Ѭ"QmF@Ze0saxӍPjtI$2SsT8rFҀc3!%ۀe?Bڧ%J"]J H$ʴa6!q#ku& u1 ЀA+$cz/"'D QHZcD+QL(Jh修5 Kh#t높!?"<wi㪢t`vx/RAE"+ F|c0F"="_RM3@cF̲M" K?Z@7Ru܁5;8 SoG/8 ,-)z1jۊ|r~HW/SX'@+.$5Y;qg^kFeG 6ZB:j-A#䅥  P451uWE4VFTNT`'NՄ+SkdJdjτ06*Ruי.6oMruUD {w$ E|xӓEJWnɈ<ގۘEc d#T.]Vb4ZމTݐh9Դ*Mi"F5=8 I>t=yK-N%`'F8'4#-9%1OQe; u|C#uIcE#)Da aOGTSqIVڀo0S@r#\Z8k"IP Vڸٳ phZ/]Rc\ns5~)uT|R1[pZf@)bH*{F;\PG dϚH:OS96EՇ:JQ3~;mS U~<GktY%fl}t5e/N+_VqX2Xq U<d`nhz'XU}=&:LbR2v_e}QUԷ#=X%(tUr)~2Hku[e<W."**L7n~;)5 ?_}{84tJTOj5NJ Jbẖb"s:9!QO#58ys>zA.7IA'w''/*UT9։G'x5Rusj;k~ڦ"7\泧zSةcm(:'%vКG5&O>>% 5EP)6(^qnʈ~T¬QDSUePȟ- mkh;$<9zq4e9e)>YDžC;r à,>Z~/2P+ݸ^6S Fg,}FTY(ƁcgF^šެ7%/.^ CݓkVJmQUB$o7x%dvLco&QK!hFM XKfW$<̢(AgR}+ %ROx@j[(1NvAR-APV̰Lcה"9J-5{JJQߒ +p bD$7Tmw౿\:U+wehk" :Yn>$|%!>LǾ}}OOEHZnd4/ri#+:%F_M[)Ȧnj"?D&<"}DM_D͟!QSn1> ;R q|OMPf ' ;.cI,I ͓.+\^):"7981k~I RR'[2\46pzlL:-w ZR UQ\rh'zVE/P+SM"t%5KA3aѫ^SƖ.\^כ:AU(c7Y,6<64B<6ؼYx%lj,Ak5*$V؇._%.Tc@V}jI%{B$=ϋqxad`Ue=͌Qh!fW?`&`fxu'-@ r)U7ݒwshW#s@2Y1bJ9B\Wi2&~"LEF(=ݮɯP7#2Ή"`sӫp$aoY|YHRP%5T_}9"qc :6_J1s3.w l[+Cn!=@Bf)ZNVG-t1|\@Z(G\bnH<ÕDi=oy幟6-Wz8z7 ƾ{T070jPɸ=UZ<˼lĀ\zz [grX=+!ͳAal"s #p8čb=7/&Kg Ï0h+|])v?lWԮȥ]k"]?Ѯ?]Yv|]+a"eOk*М|WU:'OKb1SF|(/b8X}NiD0dTmh,2͗48aT{gm!v&K/*C37H\"p%&P}I8VsP$Z!],>ۨ~l+,k:+{͗>NP[@׽= 凄W쪄rHڰGJj-| ZV -[6y,_hk#B-ZkM`\*՘(R";5Z4^+>zu=.8bSҐ,,H_ju#ͺ}f9!^`Ckf !!/||ȖP^zvqh._M3æsal5 & g.R;-O7}>Ⱥ^vk,} lr?9nOܥPLy$@7ccl渀=[ T4jQk^6bϹ1::yhfwM!ȅ:7뱥(@5{'Mu@u enC#jizş] : ئrS0jjAT1eL m;Nٟz>6Kwh*H)({a4?>l1YU2A!gI"n4G_Nr qv^.мTaEKDV;ۭoE9}cj\ZtI)O8oAx] *UZtB++& 5=,Aoiߴ;G+K` W8F.mVХu)1Zy1ʖIh8yKoQXDUf66b`{֏ߨ5-~nAZ("9H[k`Uȟn&j mIq3egYVZ/r%\m]0[-w0>H9=(|JJ64b " 1_@bF٣0 5-_RI b;b zXd=Qr<+B$C"63!O%a_2θ*oR/B:d_GUܦjq-%1IdӥJA{Uz+/UyN]KY3ڀ@ jPR+`'y/K(tMtlG('ڠ ̗FT4…(Gqyҙ\nGiyCb,NȄ)9NqL!2frfLE!(kQʖeضqV2LMcNۼ r|{-8EEoR? Y6~VjƖ!GԐRI@ߛ-]p[y]Tݠ:*U2[6kx^+й)ﶬhDnVmwGzCZ!(KX47N;|ƫίC<=<^(svt͢NX!>}o=Mi_n͗_^/ۗlAiCk~Y5/XּX@QlZϊyU m\k4P0NFךoh;Foʄ=E;}">xk"emV1NugϔOAk QJߐ\TEPκIt>>12Nٖ~:7QrtppCE9ŜeFlQ={j_R[ۤuWmtq96veCOY4֏(3+6P6?ٯ:$SY1z0 ￘ U=G2lnEuzw c&8j*ݬ,I놙nHJ*; ұqyڋ)9ҡSY,2i(uO㖢]Iv1}άROnI+YeҒfN fpmد&Op¤cm: |oiY U ^Jy8#KùgU! ?,*_\ :xiq swxNU@4_ 5P5"6_v. 3ؗV;JpU1z.~OpƝrɒɞrL]J8_.TDQXʆ^{@,9ޙ=S)s*`Oj%Yt <ȶfT%x"`|KB5pt3rVw4M )XT1tX/|ѥQҾiSHs.Z筡3G%Y ~}S}7+ւ?[Ϯfn"׻K5$ J@ 3˃Bټp㼷c,vbyRQIB+`i,m*s 켌&Df?S;# rE>Ce*4Q?'~ecO M>@оښ̉rٰm f&fDz~e"4m]E+ j<<њ~6EOPdѿ&Uw̺8(Uy3rRz9f{~[ЅY#:#JӢV]cd!Pj=vPS s&.oƍ_쀁jnv| oL5,sQ2_=n4#5*Ւglw&ۃpYS2y^D==Bi4,Iک*4:kRm>lcy,)_DԮKū*$^ݚ27=k<:oה@q"BmGmO4I龘$U6*?G49]1uI%_QG-n.'LM K3X1J2WȔBHYurϜ{/ߢ9-h\گx2sZ;oLaRIk#moi$FKk Ӽ j GVEeюdLgO~NN=޺U0b8 McpK/1 }f. '`w]׹%W{4!*z2k[>п-pASGRIi YtT!Է55eחC/PuAҐX kWXr v"pSA 1q* fLn4ISO`JYhw]_='n]ȁ@w\YI3gVR2gJ!v+(j̠gab ň4’5GH#+W^4XEq}^Da |v-=[ =dsʔ{""E͎uc1춞rĿ$7!"pJPGgen1˘;n裾7fe 25{&i?|8Wt=W]ذņ1W MJm>]^ёpܪy,Fbkæ$c_lb]rCyIJ8%Ea0̦F]_)bf|ޭ#72r"oHa*d" %&`$1qhũm~XtTgmzq5:O_d^I@|)==dluF?W]\|云w̔Hvv6pˁ(@s0b&OQ@0]Đ 189/u^ț|^y´ 4v360bnӡ 8#wTJ̓fL G XYj/.CtZҿYs塦,⣜rc\Hr SI<ٕ6sE@dd4enL U:4&W{GLNQ&v9Yk!I^7,{u:kNep7oVw2=u J@.Td OUH^۔i :ތ V^%:;'=Gz61"u<Z(2T}3A\0TΣ=h$ak:фT\fP '.2T/&T?X vc.$5Muj4Ԩ7Ʊ!U"}jyU뛎#k&UNG]SΝg\ySS\6in=ar֢k]E.ޯhʁ|?Fy?2"RpmElEll}ua^L 1:0l'W]8W-"W9e[ʩH/l%U]^e.݅IA{({QU\AnHEQIocWomj? >( 2Hr~l5E٢2!E =AzBC&BdgSjX45fK,niYp $To='R\KWbRNupGp}S4OTf LMZt]_C)VnŁ4m]ǴobGǰSnt,C=NLLʯ] {+vrx:q}ӱ2ZvOI#\!(Zm)_V eSupSGiM 3Xh-1}ΣVjS*6SHv֒ >ԧFvaҿ'Q7`,Dtպ&~ BDX?*֓hI 򬆆&qXq5H& 1bJ%kAw8T"RıpUohXֺ!Bx< GDġD Z+Sk8,(1lҍ$\*=NObHwr7N9HSz!']5tؐmD)'~⛧+SNSXEB@%qhĦ>vo'ګQ|sY6)'.VWRtVA:G՘\7QNi2/CL4lp^-ǹ(K{JMu1Bʩ Q)!adm#⬱iicHIDiSrH:c]Ʒ>NvXADr]:T$~'PF&7toG<Zh#_䥵sJt6YNdH<$XiBCB%w7d ʇ-%bb/B (j;4ߨii;r>;[|lTR&/uzBHf*D?Ӆ$73K̳K2WPA.E9m!Y?;84]k,Y22!bͲnE*ݰKC&rp#& JaGY mJCZs/^v}&ӮٰnJj{#ˬK֦Lx=A#PYbZ,dEl*:)g{F::nRÉ3>-4u ;ęjÖ4K/IŞk:)wiJ>[l5glV*15Uб]#329cl>cWd,W&c<ԐRzI;9W#c H61)E)N -CQd,^(%Ѿ \}KyVkкʹ;:5PIDT$Kq\I)cȿ?Vv4 hbu1x蹮uŎ@>MiAC/blb^{ kkL .!T$ҦjrB_jTuH6b΃kP'!qAwH,CWݫMFE^AoM -۴T^ $' {WI}`wJpE,P!%,ۉnalk܌e5IcW!πN0>wЃg;=2(&#ZZ6Gଆ mI_"Lc\8zDJQ:X@^)`Є^y$w39a\_u55eg,įE$q~Fp7&Ǿ{XgfO\lu.v~mc\}E+ CZ4$5+T ~IX䃒VjʹMgB}kx8vLHfR"4hݖ`j K;Z;ha͆541 ǍP(yxY`!*"(J=+ZeiD)1q]9iV)erT$hJҠІ pY&-'ࠒr?Mo'qfx:Pto05H{Pc#i~[I++7}ȔZOteBzU3ge/iFC GH#R)h Y2vMMz^LT>rr?R_ $ia ]·cFázR.M) Y\WU @`Pg aggmӀ)GCԡuxt[oIg 5?UǾ[S:O7”K0]^ xqՕq5q>p\tC慖C3eQͭ Zdž֏64r#^y}ulhzgC7ǢxbCiC<}( 4jDň:cN4.Mz0C{/!ލl(OfCy8RղW:_ c :+!~p6g!lHgCRL dN D O|I$;|%Np`ӥ"M ЧC[~jig%=P?5>0o &?g )ƹ\9@_%]Γg{\YynXOS$ȡf Xg?5 껀1[7< Pǟw\|6Yiz F=5Fi繴 aaŹgAmr9s9H_wFRlGҹN`j]%Rr_dgIEUwmHan:cF,(Mj H \m,)깟씟cgqMzR!^oa`|)>??S-R7AE" S:wZL'&vG _%GV}5),]˵7{pl =`wHlD-oz޼8daac 6s.4AT~bmw1h{g4͟WiJs#u1W* 6\wFytѨ/ly}|&"ǷMM6yfSIPq'}[<ŞE -3}\cU1PYZ9҅^ZPyOWbtqF^cx7#E?9CGt4L$XS>ʒȿV.&YOY1TVӐ !FunOUon‮?=2.( 3 qKW|zΤ5i\+Q<8 l%C(o)Q ex<njvg ' cR 1zvN΃U@ZF[%eeu;Ir |S~geҎK*r+Oa#-*7h|J-Jw0>*cxʵFAʶn:}V)w2mV ٢8fZz5 ~:=t0d bI'ToE`g[8w2ݖ"vBod A2Y]8M*4b,MFvfOAlsMqdJnYO^Dw~vq6"Wd~"^^VwUd}""YWAc=zzǿ,GC6ԕ;3wCks5U+"?&܎Ubľ=­=b^Z*En wwOf5+ə\uJ4,YYX5f4pF]!n,倚ήDX,J/5irNjˆDF{7/)YQO֕.M1_&Dw}ivXc2cBd^"MC܍? v endstream endobj 165 0 obj << /Filter [/FlateDecode] /Length 46761 >> stream HWMr 7TIe!//&fFX/*vJ}lqH@h鑎|wۨ;\:̥rLLʢl#s~ -|QߟI ^F5L-s!/u0dyeǘI6׫&WQ'xNHέ[<7.̂ +&k$ xи; x7⇨ I,ސ\}.?~Vy͐Lɠ 1Vx_/<*w?Nu~&i{Zm2>F*D? 1|629AeO|e?i%+lF^ЦQSa 9YZGUyBvIfTJ**}qMD6w -:bL~-*SEmmVi1QG}Ǭ޶ 5S E?QPU8$TCܥĤ{zs"erkoqT2ԭޗ5]}rC6]]j(u= Q pR)UȊϷ yb1}F"%96A'UBז`"hS\OۍQC[j]5ӧHҗ~!٠Ee@6cN$Б% ۍq~~ZQ\VMp |j 3D)umV h%`ptCe.ZJdCȞ76Rd`lXt6 SYlP_9AUU3PF8یZ `c`5w[ذ~mY|_egEq`ˬWE;[p5kDf6YGk0~;`nC!?gu$[L8Z:u?O-mэfMA\H@W$k-.)o`^Gx.A.V!UVD{oXQm<[x6{ Dٳ̽Wkkok~}T/VE W\E} BYY@`CvUf9C #WbކpG/}U|%| :U[ޖsc~ TIb%/q{:D8êBj]g5o&yY^JÌBL2f3栧plqyՍ-dse hn.nzz'qS)[Ƽj$ͧ_%ɕF*SpppHXzҷԃDbd&H FU'=0{a󾗋ye/7?ڹm~ε۹vֶ"&7=[_ƪ)nM&FpY鸳=q_qo{ +.k-!ۋm5żzq_qn/Myj)i3!%hԉQ؎ `(&{lP]+nm!˔ 6 [yUQCj$`4?P57<{/r0S4\6K/ $ uMU B:TFlp˲cSInǀ2 03`u )V?"[/7_hrjϗoOw_ܔ_ ?#sFZIN1lE۔Ҳ9Չy*6|dEY{}ǹcmV`5 ^ בaN쀃՗z۸zq_qn\OXvQ~'R~M9ˀ8m-Nr8?K=]k%!sF[Z]Jy&{PƳ[tXArWV<<"J[dzk0 <?=Hdɐde_q>h5?&񰀵κv˳pk{y #ZEKHl5ђ-V ) +KcmaO?G<9S`# Uw] 4HTE'&ۃOo֛tHLcZZ֤2NQ;MEJPuL7L(_e;P1 \QSx׿e\e>~n*=o8Z*Th^QjS>4q.d^+)piߚ=/ %-ym$f[2ppC$}Z;kfsh{3[!JP+թwmn~Awc_oZGc15 kK!+h)R3PY[Ƀ d/(4D沥X)j0+|kM 8TRلdt5CV]:ݬBxC2o 5x5|!7?I0ލrQ`|Ӑ|)=G}uW!9\> Υ\H"S'EWP%r(sPkS\rW+ =Oq:U:*bTZmX[iv`7UY%0+I)Nm-T%h%j~YoJG=ZĂDA,y>LAOac 0Jsd*{h-3IlZ?kI~jQZ 81T+B U{\:@c5„@^1/&BKRPtzmx--^_}Du>59ii-j~gO3]~ۤ /v)Oӵ;\wrrJ劗劧J:W㪗?k0\w?٭qaIl+V4ģm\'d_7~Q l;b_>/*k?L3߉ORd}InmeI9d']#;C.>js2% \,,=Q`@ U6J eץ13gc1>\y&OϢq Ocuu7RABRfW;[Ha4ҡ0Ҫ7{Iف3s7b_;Fe>YE4o$In$b_6s*]$*.6=e2S'Xc׼q$| `f',k '1UddrԛTG^nXE c$R 10udH7Z9 Q@91'jMēԯvޑ6S?x'8L,D;S5l$NʙϨUuѷ3`3ȝWj9UvgP TH{|fQ]&+[:IҢ3B'mSOxt`Cdo%L/%vdpT4哭cӄUƸ׺DUirb &Krm3Dʄ۸OL Y0"\Z>m诵6Ygm6ΆvuQm`jBPhKew"Ͱ KvYh!aѾV M@ ?VhZv҂AwkࢎƺK{n?jH.R2ĔFOQSYq~>SUX:JOh#y]K+\0[쉛]3q}pe)s./nPDRF{'Ou5źk>aCl?Ά G0 oa5lX~ Kk2lމ*Tb{ `J c& LZyȩ!uumʻ8iJRCS6 7i>wJmb=Kog]bK\$ނ֧Z;|۩ng޻~vǻnv};~wwb&~Q{'پ$OI>X7^n&d`&LLd_221f&MG;'G$}ٓf(f~; 7u`$e$]h$o _ ZJbľ/#Jlp0#ZlӀVv+m7Pn򐝔J!.$ܽv>Rw)HA]Dc_16? =flgo͖hYWZNppo,i2JeKKKoaKCUd0V1شjW#\ 3c5٬tkҚLߌՂcʴxEnf.7S)Xſ  '[`\tny+/u}p*st,Xi.d_/"AU[F%k@c1n59hƳb^gÈ؟NTUQa:dk4@G*H;/]+~ۦhӔF6;_^:z,bO--2LmD$6qspS ͠śMb"-^O/_^l* ?lX^,F/~ Dcہ$kOEbK8 -`UTRHw]^-qu>J]NK.ɖZU? 1Mb%*"JND8g:cO?0)y[k ~ؘM.;IG_N# #΄gLNgsWYिrW;$ss g6$OXg, $CƬ-!*ߌe\ŧ΢GD-dK̂$ Jc5ҍ踢{F촓`N=L}q޶ !B[/;Ux8O~Iݒ k;xJ03 TkۥUJR7W-1 2ba5߮sPYFBA?]?5C׫ RBuſ$7E>l(AiS@dF+&KcpYD5AK$J")ōᱣUTv0ᱨnEo5 9¨[)Tw0w @/pLqa/'ҞBiGЃ5oWY։Y&`Bm>$y&dir\ðB憍y ޏ>#CslLΝݨAxq?GG#0 a($d;V`-ߧ5=(j"ƨirN|ng9]eu(5gԫ@OcƜ(Ԧ5K_BU$a.&c}H:%&D<}W},>1=ҲU)J x ]-er)CT T ˡʑS8785FFxt޵+2SK^^tȐy~b +&dߑF焌0l-72Qh g1jC?G{D-䀴>D+ ?bOGrF K ':*q5k򦲙]YQDUTQ(9H\`AL AI/q81yz! VlJ 6I-Sjjc>SDKyqb-)Gc͈r7ꖹmaṲz\z>7#ޘ=-H-9!٠yIS[\b3Z@3YP擱҃>eK@QBV.m2F E)ś2I̙ 9?|wdMj,'\5If>_k}e1> _ٚultTHm[>}{Q mQwvw}U:ȗɂǧwɂ~vX>yYDl~0c([2P^{@Zxf}\ɗx \!Xi]g2BUE)pbäV f%5H+5!$= nbGBcp{ze2FX8u'c0JqU]*Bo iP3vK;ʯ,@q mψ<^FkQ&#/өI*8qa'}}4m?nHqʤ/CYUbCYrX϶J™BjnU|n )\I{t_rc_l2^O)"4JvS?hWu1NEȧi}NxO;edYVT}GpFIE<+$tgd.9bÇky"մnq"2ɰ﮸S/q<7 d@`r̠>4VAuRYfI߭Oj IC@Yνx,+VYª-kìNZ/E hx6N(LlL܎1zOD&YY!>q%йԺ_j_!tglx D7~QE`/%ܾx?aF6N9УӚӆ:ciiӼ!X=zas.*h)*|_]Retj+{RE𒋛pvv>'0x^''Y6~rrG`]3eHԔ99=ҾyFwP Xi3O1|S 1Usb&Dk,66[.qJe`- H5lR ,gq=a22mE -5EqA ~HXX#yta9j,GP٘HɆ-=/dzׂ"hbi6Ѽ}K ..OzWK2NѶ#:iRI=j凤++kk~pwrתV?:?j,)S늼դjxb&%%#/RA\cFr,| nu%rykJtJj#ΰ,Zs,U=h\xf/ <޸_k)s%Ylߟ|Iʏ cRСItKjVdDo%u(fHبkgb;'5YuxfJ[aR9o|_ ;ҷBeB8)L&$JxV>M , ^R@~M^"r"!>^R"[dH'%JDDە|]CCW2/:2d!ŊaLp\҄eD(@0"pY&ZdYّVGMV[qǖ} Q4|XX!|4LUs92yE"~NvVxDZPT2d.e]K>SfVt!>kЏȼ?yC3/~uP[ U>+ PyszoH(|_C>v]OuƜ| %v1hF[Lk#ޅiY` @HaB{—!L!q|(2RHg1$vv>WHN_Qi#\c{E4(vC 8ܮ;·"[,shfbe_flMbG?`vgnjVrinoz?b]Kh^ n:4KQO0JB#GD%-FCbep:ڪܱ3D?to.hJXBڻ]} g'Tuc:A^o KOr&KJڏQIנ˥B\i\eH7]ini 2Y0 g>ьgfVZgE " 6{b)_QU0Q=(+PA{э*hY}ޥl["&uX[\b5/,q;}N&!$(0( ϔUAqXP!,Y@j c0OV[ Oa2R?;2Ǐ  yB}Q{ w_` SzޡJ}hFZ}$h*WNl,-;=/,+6kIB+@+@G.2 2f1d0DGM:{, 摱^˧㜢7'A{ tFj$ߒׁkAX9Xh_ \.q6jJ=mvVPcPiBZO SLh9Ԩ]c>BQM\B36Z7խU0K 9] GptYIMϐt֦O-i_e9n +Px~޴VVVd<$AYy:33\m̐73h߮+v4 X-z/,Zd,.cB7X9MBU]f2-A4*ks5%LȰ 6yƗ^`ޟ+i{9 >qS'4WҖ>8\TQh'XÑթɟw&Z_Yzw?;zm1W ]m*jYxS'U|Uȅ**˨b>"JmDӟu#1 %ָ`zvCcΗ=R+?=\v&RّD1:"|液Evpt;_cOgzWS=˙1yJtd,᪸9Ab4Ȋ\+g'g]7/0P[q u >V~'ڲa?dۺXshÚ[JÚY rc fּ{EPa!cƐm3m3k!xY,z1Kt7W ]"Knp룗u>#YNT)j|uyǾ,_t0FVZ=y K|X$[ddTFRآ.?BX2v` 5VWuۻ(j0ďb~o}LZ#_Ҁҳִ{Œ f3&#55V 6RrVdTXec5S6lY)݉i$ J1kިCӌa" RMLh$L~&)r-#gn8GV澫'[B=4m$oJ#[ISS'yDOhZ<xy JGqWfpt"B?^\ Qdn0 !ƾDW鬢{w ō{; +o 9mWA~E~Y~;?qN̖ ]d61+~uďl0RpK)ʴ!P@Cr7l{`BD8dd3fTf`bHtL3P+Wc7ƪq?t 1\bi0"_&qLDE8IC8$\) ^fct5-%YqM1rĎd%U ^w9GBsW<|񏗀t%|4ޓ\{r,OH4ei:^]W?/y&v~ٕJKEjJ~v/m.FhEq@|$IҾR󈺚FatW˪R^ê/ɀ+5eCĉh)@(aGt,e{ㇱB[Y^Jd8J;$#0vu l5LGRKV;gd P]Wjqbm—s"i2yhwiFiWڈ{isE{5e'2SxD3rmayOFF21Kֻf!C2Eݞ9Qo NqXMY:;+гA^iuL:YOWgC.,faUԵT׊ mZ=nn]]ɝɻV4zmO'iwwI[9KKTh\@9#<[`fQ֔1>\EÉhdLɅ˨l|51Ym*%N*s") ,6d{HIXYtյ < =6&W;^f\sGIޑo!hM3ΓEݞH^FSnfu7kֱtvŋ[ٗws-{^~YȗsPZÇCtKE\Ϫ˘iz[*6Ly۝``遥JÎ ԕ0E?@sNc!3YTydۘ`E4FhV9+L,nn, =՗x䴏qQhc!WWS}ڥ͘QEv4tɂ: BuJb17Q+ݰLUMذcu4!. t.OvSgY wvx8^|v?\嶖ײmk)--ƟԲZ6Z6ދxfffS͎SͶ?fs SV?Oy0U~_!LXSre "o+m+89WT}ɑsdP\Boqʓ@=Jmv}pv.iƾ3ImxrLD皔Rs];X&/a@*$Np 3ն7@*!BT- Z)$4WdQ)S[P41͒MCpt2B1`p-{S4J6 =$K}^vo%KYOo bze#7ɄF7o}h9 30(Ă*O??wQX}EwN&ҳ4{yH2琾 y,@t(A@Z$)%B$F%B|a>{x0G<`'dG-|B%Pzon(Mé @{ Ϙm$9 "\X <ցnkS88hJYUm~X[FJpxKO<V)/MJm)*78l6j)e.` U7+,#a:pe`l1Ҟ! -XN0VY!KЄ+ n,ԇ[eDٷ]c)PƨM0yX2f:eDЮِ!$+&t%|ؿWBl IOqLT2Q& OV|͸+2!r"(Tt=pENf9;e,ߋ緶Tt&|LY*" i,N.!鹑R~ uGvHikBԡ1I9 pӱT1c4Bd"~Гӧzr=9}'szr-ɟ)W (/G̨xF-#Vl4}i87{K 5`xk}KH Vh_O$j.XGG^EiQһWbw,Sl6\$Iڶ Fn BևX^kz| q%Yn+N`,bjHtL Ya">KtȚ~C`W&#DIzZu`;>^e.>rD zD L{_ |EzWWWW+ꝯ|E=}WWy8EwYߵYdr&&Q N%M)y{= 3r$]+cj͚?ZNQ? *m*mܫJTi񧪴Gùipnp9w%O#AN3]N#S:RRJ'RRGF'ԇ_ͧqS m>Oo;vSa`CWSe{l@^Αa`Kf~Of]9,%jf:N9ّ=":xSMQ&Q| ew|/)!^(.d)>RP(sbo2j.*ƥ|b IS=s{yU˩2aJZB&,4y ,$|a' ,!!{HHvc{EDuvJ{:֩d7AdQa%x?9t_5t>u P{%*Xnuֵ(!*0^j=qBfc 62q#@"uԝ\IjY:BPѦ`Z 0(@a}|siSpF\,B'#DD\K_q1[Q]S|=ؿ>9ŦueqMJb_W7X}b[ygW*wLuzDTo]eiڜ uF8Y5kՑI%Fo9# fAs㉾EhWȒPug[l6>jj>v^;l׎9=%n;*e:]͋;*CzpZ}?otC9Ucr!Pz:OrcKθe\~c5)o[{˅Ddt&6Q 4ˢ1H/uM'EgKjBEнLS1lŇyR9 .A3E¾ e sNa];օSiUWzہ(THUҺZ  3Y[`C4&@SMAObPb@sDC4vtKKr,vTǯpjWj;e!]IA9.fzABb)b_{-i/Q5))).4 22%Zy\^Ù[NaA8J &)vh7H툹$hR)9Xzy?'4P:g/И^k?(257maM$Y")|IųM$P ٔ/SdQMhijKߑR[]W*O [δvn<Cr!pjPYU{psv7f<:1PM;.7_=.']{ ~g60Pe#o4~TN-@7؅;ȭ*-6 ''N<ϬQc~ڋخ:{ ё{0,!zZř i&>ۓ#>m6W[7m{V֛7 E2 b^,QF׼'ܟ#u0 6S1-_BLTsJ ,,ֽuc6Ĕ۾CsƺbM X&h Xhވ`& ޙa$D Z-;Ŝ)Jt_FgzZ2ؽ \JJYnlWtY'dѪs2= 'j)oe hoQl?:g(Ry,g$N2 "!)'2\&:H +mա}lBgw>E%*F-\}mIօ]i!]F\r$өQh[;FS7N|ې"ƛ ŞқY,k=|RIe/m e8<Ǐۓ#֕^A/ɴk;+)_{W%: ~8WӎCnޣx;UÄ/kNqy! n[;">oiNhC&:go)u,eJ6k\r#mO1jA26fC +!Z<\+9a Sg{ AoSwvYCk`1Sy/ƌ]6Ù}."n I_3_|RU&'k,+KL*z'%ZsO ;W.OtΌBoh٘YrG4q )~^rz0{ŝQm Y;ƔتV BE>`0DQ18u9tp/f\!^^0bJ`Td;Vh3)5(\X8ՊеSLA{E0O  P3orħڎ5&Es,%,5IaRi\q&J((SЍ,+Z9"(⭞krZ$.hpTʼn;+])fkJ*Wh%@5Ked?U0`? _̚, ˯x6}JT3E[AJ\aӚXP5,)) ,.Rr{i>u]Y/S卧:X@Dga]1@EY#V8&4?-݈(h$- !' ykv5[%V2k=bݯp@+9 Li Gn(FMIz=CK!!.XWZę%+VKaK3,}WF;J5:^EM!91dN X8!ᬽ#qΤ&YNV)X|jP9zf|fe *ɢ˾QRH6I@̣D^%)ٚ @Dgbpcq}sRF9_9;|])RW䇺?PWL){uehj~'*'j FyR9 SLHo&]wW75=rF)v*7744r̀p2dTEBϰ?3,ؾ- Js[Kbڦ; CC\vj[l3BֶķΉ[(978M\؆8r𼉑N~~Fmi\P}_bj'dڟK<~[Kh.-ԝyr8 ݇4H\pv=v==lz}tgX&8TD^.GмECse=̊Dy"y-RYڤ8W8^ lM8aGPCG "`? < .vz{Qe͌"t@N[:4 z[ &{U Q%;:iyl$HvmLM<c$nDsX? kO#:Lw|>.zaW7<('mEJ} ~|lfF_Zǯ/k8&DF,zZPfn=CP*9P9vx:FR 0됊A<,G!QXeP^ 39I=EbCJ"3^@=0]E&uAK$ܾwĪKvhxQX܎B*;|y𰨰tE`0DzXF=nU[r *> A5xəX">Dž{+Bdh!z(,-[:Bk,^Q*CJFch _Zʫ1z1l(Ua$frF偐˅+3Mf'BišuY^v6vZ4$a+W0`TE%LgSGR|.,ᓲ.`6#CZ1oO=@{XNg~\k}N1|6 Wy˨J c<èl^:OJ3v@t#ޟceԴ߬FϷnSnqt2A E̓w%ƱlA2଩nfm?2*ce:v zeXTމLB~2x@Uetđ't͍Rw#8TG^6q3H\čT5-òڿНZ b%YOَjR2.'D}5fQEݘ1;2l.&HB-S" 碄^=FiAޓ%@K2KQ &uVqv˛с 5Yi( ztd"gn'xMƺ/xDwJK .88 AS:nTAhYfsTljۦ7~GxՊ J"ץ#P=+`wk?"{a$9{#+ *:l;C$:,V!tԫ1bę)F"t)Gt5^gU۵dECqY-` /Z|*pv 3}zCrEfoUEGld }Zs{~Qu@{LV7'BdEj^LʯB&d2.d2d|LviD-O#Q`3~$Ir;_(Y{(axrYUMr4fC&]xÁ9Fc p! mJ1@΃/n:Dģѯ U ʧ-w\9Eq2] *N;8FJ.68mqt] ve\%T Hi!U!$fb@~ LB_`e0Z)KQ׾ ^M]MQ 8O8#xSc3ES9 K',Na?H#P,ױLǕZQa>d fLli¾g6Uyu^=RfR]n@j#]J gz&z- g'[gCcWF;ƮOcw1l_ɀĻs@帄.lq`׶'AQ:Nk)?^Л_̂E:]_J=*84|4Ҡ;XěÎ-JUZ-K/#e3s4cR;tB6~EޱPT' szzb/O;%L2}D^y<_TyD]g`'^㛎i֚ǶIm&FwZ9Xa\KS2S3H'K2Zegz.y0-R"f>5 >ulg7 HhTeQf[7Sa@lnDI%͛=c)Ijvul:ʠ y^VmU5iP5T;W/AB*0v.]y ;m'~ޗfPScHl Vi)m-Y6E'aF#׃t1YTnObQY(_cRO)6:^T[3eUZx"KqHTl"4Ip&zia\nņkvZ".;kܶEq\ 0x.o *y1Bff ARccSXt%2 Q6'Pu*,'V5ε(ӴVӾnF rK6K?y]Iohwȗ+W2}^(9^ D*[s(5t _c J Nn gxP%>c@!G IK4cR#„:eHLqYw'(6Vr<1 YܘHETOd4g-Vf5BZ/iy}G,H/2T!j1d /ȅ|Oϳ= gAkL+6dZAbZOTlg<lCcFOLX rIBoJ>۽&T )dyU&W%L,SٶbT <+#2jRXhRؽqU1@^Id jbUCsՋ[nnl&@/dŋ1draKZv~p%hǷW=.9vIHA )A F!̬m)[t;s\s< ގ?kDE#xAd|`Hw)wW-縂Rtj=tXHbEWԠQw&-`f [d!4FʒH&TTe (I$7k\ 콝ޚ\ng1PR< uجa$-v ll;f%nu9P]$Ϙ{ ܺ$7RYd$[s \Mmz"/rDUEDfpCou1GkmR!֘UJX]d`R *6;kK/y"-.vW)) J߼gx%/F5P{ޚs͛X:+5fsc9~ ydb;{T2Y݁H>[O-di$IRkh vjQ$!&(nS~(EkgtFEbYf[ Mrd/P9v3:V}Cwӕ5ugrbC Y_-u$9pS%$Gh f3S[1F0 3𪲘%Y(=0O#siupKHi:żML6PvcJAc 8꼕\}ܫMً^LSj9(%r3cՓ~>RȳA#0q_OC1Z1Ed^҉/2^Ƨ!6=z2("nӆF9~7ƴaYX-<.$\UY p&3aY<10zh ;s}`#S*G,󊻏X/(g_-]\r+&SޢR-{._-*eK'`G6~6PજHQ6P Vrl15zdj) (g^X&yPi'n_0H=)vlǴ);P|[\_6l7KuT$ߛXiZ0=8cߢ.=mpT\k(+m$V Ӕ2J*ݸ3{];jzv=KD5dkU_p Ic+wщ;'(mDS)ؖ7Ķ#=:WyR00I9)kG3LT9Ձl-3C*!SZa]ci\`| 7eK8˂?I̴H7Yq]д̢&I@fsv;"o @a *K#z%a RQkfT:M Li<[pUo {W4TRMCLS QJ_ S)R\4?+? 5%|W~o;3]^@M)QVp;?]_o%CoLs IVuc@ >Ue`~ίlӶ󇶳˯ۘfv$bg{QԤۡ49JG[v eoyr@{$ O{}34NE "ѢA']gA e+f~9&Z񆫭|o$|ZY~/E/UtA =[ԇq.[l!X/-n!'R5?_ תT3XܣԋvߖZ;m{ qUdžpm8Xjs4fiv *+v1h+Em׃c(g&4nG?>xz;Ԏ|]Hcw/n+vpfI(Rg~0V=W8%4iǼF M n,o 4ư]Qgr ~񜼁Zp[\{$@9I,w3t~Ϝ]l> <(*WˢT^z3uH|8mm'S 1ToP4+Q1T@7-c wImmX*#V0bh1Qw9xʰ®-Rc[tM<՝J;EZV 5Sa˚txMySt&?}$WZ$zwɲiz9Hx;P))gmg>h:fwՋ[ɛ<\Le+ٞԩ:~]0 IWt PBO MԒDςG_;OY5J8eWI|K:sCƴѢG! /ȴO7"Pz%1OAa3ò@M8/ <% 218͌!be2*ܶT`e%"gln[R%(5|'`ZB XGʠ&i{Bsedhvej1tODFLiFG!w< {u|o$9# @r_1oьø{DՐ0$ .pTU.xxxgh9;iZ@ rȶ@iA:ܡ=mWƭpGo,G,sd3gQ,oƜY0chzRCTR:ޡmn`U2]mګ~RG%V1Z:'W `ӜP/I]+/|ߪگmUZUIhU#A dV+$DVl|N-V?h*"f45kyPNNFh% @VaD\8Ʃg2oFT6Də^? >±͎Or$*uR /G#VHLƍ4izs y'fZd1_H9Fǀk$\8y6=LI&Uux5%n?dIOnGb( 753==owMrW"]@(n8/#:g͚\Hm)6R!&S_XaMvPf(%Rhjٟ}HV۶Yج'P{RY=YGks>j=ڔX処ta2cǓSRـ7MT!`БB?ɧO޺r'J:BJ"{tp+G{3wcA %jB$,e>Ev\V[ڠAAnNZ)YWR9.VmO蔇ltO'JC.Ye@ɊjA߿5 "&i&8cS)U4Ѵ|7 NG\YYlp?K۷|2u[U3I-Ml0ZUZ?6N=>fL5/`[<ѫ55P[RSbK$%FDp+yY6YjXQ719ofIy[ hI2)?9m.yvݴvE iC2]͆OEP.69,G1-vH%8h}~N6kUEA)'N2aU(O:Ni(q3jxvogMcj߷R.uR p+sB- c2dT`_xU~mӷ'jF`FfrL dCkh+ѻb5̫9Jr}Įq1OT7MS$mA RC֪pr_qL]W)9)AEgV]ض\_ꇣ>oGgCQ^C`T@Q&f5fMѿZh;co}yɠ^>'jlk_!s:͝Κ֑)N,Q2!RN AUd#d4*=zZDz9'$GBnyH_Ȏ8Ʃg[Q, ΃5u.zmsĒ_Lܲ -Z&R}9+9\e>ݒR8N:ZJiq)-Rjﳃg婤4` eM"A3H* {I3c \ 054Tl M 쫰X+Ak⚤ ',w z>#^JaM⯅)z'@q*E_o繐.o=E(oȕð~ Jj&0`UeDZR\H<@{Yϒ;8p5p3ӛF;ע;ݸb/Z\(:i굱cMKD= aUӢ2Ƈ) mg7!bYZ)(*oYM/!OH!~ȥkE9`F%ŬY^s_%IrI+r_3&380@4&6՗K,ȴ0ⶤ <# ]`Ptn@hzzu ڹY8gO4R|HSOn'0'c87뜴>Zhv0W>3ъS,~7XCbUU5ޏ(e]ɷju){w_%q o gxgV|SFLS(XBVJ}ܗú8FʎpQ#V2ِ]J,i7DfF$ܢ١yMѾ˃J Lx`DL@^@ >r'+;($1H[-I}$~mB@ꋆl{Mj }!9nƹA+~{G̊5򈾡/ ՛O^).{ez^2fj)Rnq)cj ;#lO[ʣLK9?ewmZOj 4}SQPoz33y&LG~nj\1\w a6_v+@Pm -_)h !cӪD*RDP1v%K Q[X$궥JB[ +a j5{U亭Mm+6YI@=$1 ͆HY):w--N;k`&=/~jD̽\<W Hx*ۮ&^E%W`@վrނsުT&BlWRԴX&W.Mڙ=mkHܗ]Ds);B=2h5(3egJT8ȵHM-~A*R!j˃c&m & !K03Qa`M$J)$Xd*D굓i3ӖIs\gB׼0ua, 6O^,\+GzD/h(CU\ƟU\ ą(gCϱl;Wrh8x;b|_n鶝zv921Qb[30mXI E(޲ݲt3V c+rbLC \9IrH }L7Fyb{qɩ#EJ`^)t*Ӗ"6_ƨue`ݨ)YY)H8&FSqkȡyյT\W{W'ez=f3=Ϛ?oю6gygI[I{I?봭딙c%%;[L-C8 ٘pֈmyjL +ߎZp^?}cX[*|)t8 fln,A*Õd '}c? ֹPu5e+'[G".r4>N^Wd;]wT7%:\E<.cr f w]I[LB~H4̖IewQr-Bۻmb*/h-ZYieU[螥e-"/_;a`\6-nh1c'kno; ](թ)P&6E/ZC܃;& FFͮH$nZMV0]>~lFWtEy'Ľ"q8c(vE~7L0LTN̳(+$WW*CY#݁,<ْ"3i{=jd"N|`]9PpI~Cs!#v>8d+F@o kN/O02!N=t Ɂ+g]>sK" n,֓2jt2Ҍ7Px7JBݤ UE 3)R peEq1iQ/PERtו/]>^ubS÷5xfcPzf1ҽiȄhFf9aѣT- n^m6GT{GLA(SjC̄x/%H~ExIQsh}Θ AqC*o/)Fv@fVz5zk#s>-ΏAZ%]b>.w5Ztv4vJm8P‚ѳv)F3ZZ'-HjG>) Pـ5+5e 7 A*Q>3s7s ;榐O^>XA/^!'Dbd Ep1C1JME=Q1ǟRrKځF)Y ]8"v(Q-(LiLmGHj x&h\{ޙCH>WEDfifkɥ#8ֹ-xpg9h.4ɽO|I kIS`]$'C֍L(T?T~ *`$NJGRo2d``R(e=\q_w9 Y#Z=k0e֤n1:>RǾ˱o<8L˽Od_[FFM);KϺ8j䝮,ͅeŖ4L.mvJvS >ۃY'u1iFD\scbc01snM~Vr#4lxѳWOR "i$OOqsؿpSP^rr(8upDOd=?du:Ek,$>"DWm#eI$X=yIK^|O O[r]wwBeL; e) ҫ]AiMa/%:tƌ +Pg6O7.-%9b.z0.s-6Yu@؎Z$s#h=;Hyc}s("8Rk$u@^B,kH|l'=Q-,dV<%bͤIHJHz?oEܑ2ݑZ;8H0i@ij^+)ilvanٟ%-ڊ1\59ʓO g3(T$qVeq pLKr E`R삓[w/E }S{uCo c#녬jo[J_hZ5 ^祮W|VW*g}HmkE& R >yǦ h;#ݣCLzGx|ܣ U.u ATrc7|IM_J뎺QYtVuPw dia8r>h(+ V a~{`|ޡ-dU/촨xVV<<8^Y0-gvu̡]BTO1 T9IEJb/AHT[*'{.xW- #266[@V[KcKfRUFBϏ)6pk[z\m1'LN4jktp:WPBS3~;PhM={6sw-Oq;QӁ4bbuǧw&wTpyչ [9Bimd(=ԻwN$TkEIw]zɁ^I^N8(Ih+Yt57~$1Q=$4IdV}07?Փ4 -S3yʑTr41|  u?3Z_#mNA%m=Ԓ?? :r<r'a~/ $L^N^`botKFnz  =JA9;PaT@-t2p 93Y$bkJW鱼[rj5:vjQ 盟+kUXvߙ51/rF5\`#1Mټs< k|`3λ87O]9f9F8[+V9ˤ֨rަ<ݜX&ZTDMӤ/*49G$>`f N>7($Ay^s$UZsSlIڅ<3Ѷh0F!h`lbMP6eIg68BbJc Q ,A>FIi yLJ} H;/EcMԾ&n ]X `y)P>nA?-VuN~r{}iƘ;#l˻m+֧c0OJa$S1C=@;;Ơ %2a!pe%{ YM:TE~7mُt;6ړBwwtߐKoK]g.7?_K] ȩۂ19֊L(Rj>R+>hۀ1nn!&]""lKbS";ݓTaLjNZFdnGu܍C߁}onY glrìUu8 B_4nyi}^zBd [^o0MA/=0`/T>F%ї%S}@U[u{q]!sT_^aKcKPeFJnK߶Aj2k=b㶷(4cXI2L8DSwN?R#gX?C8 )[!% LG@0u.yS7;Fndn¾}nxmڀsxQE)Me*xC۪E454 nՑ\rs ^M7Zp6BLc%n:Y&Y랓=ϨG?,|w_rQ]{+],\KIJXS*r y 6a%N뵔ZX)Y6KI%.!?z9Q'X4hT# ]pXRŴ|rJc9L”(/VYe|[ƸI܎+9 3ىy9ħMJ_tZd;;; ?!mIUL/?pYZbZ g@g2hk; ޸ R*%;з/f1,0PXGJU}A}Ϻ 8׃wp]DsU`u:.׈~{ϻI4n Y:d2=NN]2(;٧0CU@@b3,Uq='.̭$Z %fqm|աCՃ%whIDS 4_&襋3*,)d/֩rNDUU(g FUķ*Jajb7|]a+alj==÷0vE$;=d8qn!=t.Fe!Aa!a<2C֓NxYB .4>ghQʎeX3"#"q7˰e79`"ǛTGi{ #`wFUQ_tѨӸhU2<{B雤x\\?>Vy_|hK!Q|4g oz=+_/CpʊFE e'JlF]J!I+?h"KrzOjLk/@{ qZeG%&JQ2&4=f[-S)"D}GdG-Xfڃu,뵤 w5I,$0D4YiXPudݑRŦ;d=WmN`5|cF urV P2[QH 7_gQJ.qE90[E~͙&!g\rHVPW 03B%97G*'ˏs>rsQSNKXyuC_Y=7頚g& eXSN hf s+^iͺKw4 1iV--()0YPV,WK6ڍU)MmrwiXJXL}eurswc0g hA<;K"0Y")T`ƌLUGxHe#fJh8/.;c L[SVzK{/r~ 6K `o(󆲣M?'fIĔ[LK_Au?utOC6:2 rMRzj&eAWˬߩ9H^z6C$iF>Km dڝړ JH4zK^W=`̡ /#m-Ph!-IktII x֛lF3*<6H٫p|#D|VdY1BA/+7Ι'%$YM֨:b1PeZ]\{CDުUVnVv֎ϙU&̭Px\#(O0YDaNeR/:gaq9]Nۧ+sS_&EjFV[ܞQ)v!E;q&g94HO'ZUH|Q漭ZD 1犩ER>AH3|ԽO`baZ62kn1}<cWa%> mUn}@mT-L]-8R7H?}4.WP ==J+RM xJH6v+.YiME͹nkB&<{kX2\3gv}0xRe_5ǂ^Vu®IF}^B)Լ<;Q|URf%jpqS0Q$G̒@A&p9gA}z`kK^%^7R(h.~$W}Bx ?Q8bpHXO{a{mm#L$I>rI-%]9&ZԣᚼⳚרu!]W({nH;tx 'q%0'1[_7S.I %AoTs0H{n$QwIa̸ U2|59\08`%,J8Tu%zE. 7iY* tig>ZǗ&lMٚdk֔)OlM?lMw_k׾sccnƦݍM;M'fCy~dlil OΦݜ*_PUEW@_ Vrz|H{ hט9L$B#Hxo1IIB=]AٳnlsD} VZh)$o&YjVRRDzV*"6]A]ip1 Z\+'Ar֐8  Ҕb9CZ/QZ|A}#qYC mIBwd)Qm'r^27TmIJ@"`!~UqKvA5jkqZZEV6ܳj5+x(sbBx<]2mM -Z~mXSpGZ1"ƪG8|F jk6_6:H#+|Rߨ|asEhf8"11Ǹ i*oW@-j„.$EP yiT#t)3C@<"KjTuꨗ^[Q#5$㡦,܂kh"n ՙYƱp섄_ lUK"hYcdO c4΢xzPݻ?Mۻ6SPy jp瑡@2;81;-u~r(2rb"Iwݴz7WBꋙ &wrjx=q{r5-n:3:‚d(RZ+7TcvK:&8SgtZTfmHƅX%oT,3]xWtꨒi|#2+NDew 0=MIt) q*Z`I4w$K1v8]j؝Pd6#sų Gǃg#zk%-Eb-S9lB23~tԐuD͗ҘFZnj'p*o.cH\ZYZuZVN-l%#io &,k@yNiDZKu ɋ ;oL!R6lvľEX *|I\0.EF-U9w)~oc[<f㩎ߗe#eۗ,{25z$eK-@]>p:3BFiN_?4w~ _ `7BXKpN͵\) N~.[#K٫"fYH=/BB($v2YD"|O=UEEk ّ>z^ %z! \|K8?z[/ӸhOVOvD;%X|r4KE|͘Oz!n13q@' !' d.4B?}vTךBhƊzֲ`!jE;-!sSo]98p-v{ǧv4#U@ZHjixhkQp947;\则JYl";[#MOO)*G0]9Z"լ:_Yg՛ĥn1f)o6x7^S.{: yc4Zx 抚(s!^ 8nZR 黲Az]κi|:eIR@P<!9A;X%fR(]cZ)#QϥnGiOP48aJiDM>ecfW5Hm%YMŪ Ulzg|fhTu\ae}WZMM?˴Kj3bmӼK`M1s^$ ^`Cyj*e_fdhRp )(-ѝ>E Jdɍ1dY7w*1-C)mAn u`eΉL4>DI%^(r!ez8** Nl]bQX;ś'q?90Qأ%Zɉ'Q c龜&^Cs.‚"CbˡХbl9-AE̼>gL`G@+u>Iwz`{p/_śhw߮imC)g!0 endstream endobj 166 0 obj << /Filter [/FlateDecode] /Length 48593 >> stream HWI])y8P @Ð @#|V_%_5EJSP0!oY\jutڵP\#7ח_G|zZ:x©o/_• WqaYz}3:a&nIc8vD Lksԑ!LlG*?H$S<3o%GJ)=^}9QE޽{~WmBB;q3 z[mk!޸Jؘm!Dz[O ḩNB+Wb~ x屉9dLL~5F:e.Gֲ9x23+ƹ`|<{ O$[+[bRi}k{W,ՎqxU4)otY&p|D_VX@u;e>h}!@Y}d6fQOs/66 eV/^!ۭHvk7Օ٭\P[;]W?m-LmFJ.bW%F\! Uͨ"nfDu#xªrf|䖏]mב*Ao4wj@j(lO"d!H*MU?pF=.Nm{,g"uT5QaGAt9&ӚLuϹTP e w+I˻KY^Z-IR ?{7ί/ 00KHb,q: Ō,#j(ɊBаi}t%'r>tf㨇 WVm9=f&`Ȣr܎^?#4x`I@㑚#ʪdd+&(?g+;|Nr=3a tk))+ULCq!rWB rE<[MF#&yӨ.(4%XobSlPNٜJQFN,pD1(Fd47ɜ1E(HXsԒ46nBP9YvU#l*0sTd%ꑬtF!y}:7I*]̂Iǯxn|ϬUE'JM~y,f<stClAK ]d z4wZZ,Slrfrx9,-ٓC 'TEe8]R"F~bzf!<^<(j]FPCp~LOs1(7:?|ѶZ۩oR[Z($F7oW}1s{ZdLzX?XO ~_2.vZdQG<ؖ{EY݁{]>{bmeﳶX[~k3kֿ$k,>I`@zn:H/ ^OGTx\6'E}>т>̗ 24=m4dgW̔I3l! ںf,0lxqg૖8`F0fp&A2PB3̩6[ɆC:XQVDlzy/ Sua6%4\'Am蟶c)rfqR8,h~i(&?/:^jZȡlˌǥxlHʌs"DZ2M5f{^]ǖñR|R0U"b.A+&57S♡Ur\T`)Uj\:4ɹA,Es(1o!H#$3C'&әs2[,v:T\9.P y5q.B_ى9-23A%L̒f){q`Msvŭו_%m;RS1qα)ly 6E̼+ R;87-.eYvܭLgәET-JF| RPA - )]\P9@4cArծ/jF / $ .Pީ,3T $,D1,lL '1 M+ ў2+(x <#YP(t.kT9 ,p|1zŇ7 a<>Riyy 5VǪV+v%;Ug<`9Ƕpr,M!YF{!Y=?Ae&[-ٯoڶ:-UJ S&dtc;di()dݔ~pU *J"X}+&0 RaJ}Zť4̂4Ջ^)ut0lZ}Vv4BUT2): ]>DڽGjٛYc\FJdΦӹ%}imrL>]pkXzNw]~Tv"xޓY!ilX+IZ"qٱL3EEk̰)bXi ,&g)\/.j6гDR<-[Ć~6X!IXo[nT5´Cg*F3.mXW)63+y, jWGiZBSZ,2ݍ{]|Cx.Gk7X,pKj ؇+m:^™4 ZyA%JQ7dm:$J>:%]Ui][VcdT[/Aiw9_áy6  Ix0ީd"c fMxT xbeC7sl0S?""m9..^x9g7&|YUdB*JgwZpCyTU YQhǰnMv(5.?!Oj"sj\NǰRJxzUs4,hb"_%XH.wGHe#qףI_l`s NZ.1F=]gkmd.KSxV{X{]OYrdP;@}/M"T gɈkAyoF״@f`m3u1{Y6J:4a.dF-</y_C;> ݎ&mm5j.$ٞRL9N* 9gѦ7EI6oDu0͐g:ŭChxap8E>;0Ku9@9PqFq,%xx&ZU'R6YSmy)e[k5u:ns_7 mbܙ0GuJ4-|yt.ttMȶ cȂ>zbý1 MNFazFrlKVa;qx}uk_=Αa͞з.L~-_j6Ū8QsUVB_@#]He Br頖 ٯiڼED骻v:?&qMx+JPgI9'! z n7#;6o,w1J|J釉8>7,7mt/oQpNfT EF`coZ.H ߠӮŔp,3p%fVPKg4i|#ᗷ#WoJtU5utQ81R k_f&%W{'7)U z],uD׺=g憘KP!ݦr@޸JNKZky]Ï-A Jp m,! r'H&TG).Ih;0ʾGvjU RGr7קv,+hs1fjԜۢ}7 A_ CbZʡvYWsHI@I[h| txx|OqpN&|?[SL y /+rw9"Sqd, ]M&wJ͒,3IŚZA?2įUlho3#KJǬT:R lwIu'#{*cvnQ<‰2B]fZcInByJ Y]-i"dgcFJtUIXuQוJxӘcJHM9)z/$j|ZWRLQu䬾lZvyB7 >R/xC:V\7A>Ȁ B}xa[ݚLGN54氷r(Й\ĕA M 7t~TߊZzS&8XZY;'SuԚ!EbC`jQ@'7Y]Jyʐ jpavr31õĹlILAigOs{MF?Y\ _/V ܂' s{~})q IЂ\ 0|Nẑ`(K^a:j=:)*plOML5D^, S;x[Jjw7ԽS-t5^j< E`ĉPFd<mc&@IvL2Jwt9D}Ms}g8YO^d)=92^FL6vz b*r!`zW-F^2$ =6C|>3W8PHVV -J;RAs+ICehЎZSrSc߆,906ϒUɘBSE.` tm*M%8 51Mxδ"fzRUsY9(Ԋ9ϙPt)t"_ d5gCTef0=dS}=2 X[fOH>n_::.);CԋvvD``O-a6qQc 85qAB2BLEe)uu9);/IW O@ jl(ܜƺW= iaBJ{=5F Tq+m60K-H򪼖'un: |7"ɣ#,%EʚoJ,s4:N?Ҥ-o,rP*Y7H't:H5 y(C]yJ}~UNyYЀmf Ro55QxBK%:U HKc|zZ PTn *YԚMXU6VהZP ѿTFlLhdy',)j<3peWc=2_಺M0ؾlr r= .p-gQN3:5wx77BU2~rZX$Z|PöWj ݆V*rVV4$U? _p_0+_r˳NSãjkPV ]u*&Sv25>[udބ Ŋ*jRz9-ݖ=Ъ<>gDR5]HແQӈɦ^CEZJVtRLi Q+h2%j^Y`9)fMt]be2־.VW-abEAp]WW_!1߮9|8\kj BKë`:Lcv)Νy|%-y~\QbUeQF$3Pe"/KQiw^/{#VO)b;ەju}G.~M-Xj wѭ5WfU_ӃL=~N/zЉK}X؀1NWnap0 -EѼo:sGtuR!VE8=ù+T]mizgRr%& ;-A^G\spMEK\pk&h񟻞vh;Dvի&RkK=8@ԶU IH~$Dn;zHqQiZ^l+?z!7}FIf=#AbԈa;'bı*[o{qWe~ߵq ܺՒc7>E]@'c1=]EOW H'h,J)X`Y+lbJʨˤbC+vݬV7hHcݜx}n&duNw"J/8:iIvt? \2ڔj!7Q*E׽|F~n+*CNfzF+K)"\+ЗO^ge@1k`-_j7[Z ; @w:uy~~,[% S hon('ɤ/_\W'4S WmXٻ΂=3ZЩO:oF=Gewx3h%;D!.|s*;vwa084Cˎsk(OYsz5iVp!G8@fYĭ`zUU2 C1kq*(jAC¦7X}Tɷ5pZPt۸y+I ($FO9.G [)i'QalINT^d CI'/d3(QO9cAd#,fa,)w6Se}ȂFuC",dNrBgEPX%NIb t4 k `X0h?Ý-Q^j45j4xBԭZ6iC=et!f\>[ @HQ!:rVɝ#FwM첉ΧFwH|i+GT̾C&h@@.p=Nm(%%3$#Qx夡G^`$nqI'[L6eI1Mώ,,YB;~A[|Z%%zv q6k9)D0])lꖢ"7g4rQpź.pFOuqr0Xc1KutP"{l~}\7}ՃI!Cm);<SU[;(;Mu04Yig m[v?:WZ>6}4f,O&zFV:㘺y9+겂1,] JkT2ۦqCBS)9v]NS6WW K(Y.h!Z |)87R īzf5v#IRrBY?Y Seľ1EHTWv*"k&+ϖFq7gj*r/mFlXL"̾h5;T:9Fb/og}8u{ҍ1pPNYwUݣV\vqZZ AlS_$Xŏ&]0 yOUWv#}v6m%n|)=4.DN`}ҿ Qt>18[iQHɩbq-q:)Ȝ<%)5|Yvݮ9@QS;xA詉~O1teSdnbz 24"wƞS!,|~ȎM<3s|ZåȞ0k[D] f#NTV`Ak^9fOTVSSQbb1zO5C _8iSr4L!P 4xLw !O{,-0)bЈf'"t\mT|+q^vKϹ<6fr&[*-2YW=i9 8pf$Ղ!\ΩHr|y.vts#.KTف >NӟVrEƉ3oԧָs |_pli`r>S\w4;d7I (#`}Y`=Jt*GV04Ƨ*jMʥwG :>b&@hZⲥ(/P5To j`6G*M,ސF@՜*1k_&-ⱁւ&^m/!f)IB"-Ϟx3NeQ.nm+hX.-!פJ hqvcPj%RxfTG]"œsy_n`.?bR vmʒcllȎ\L85j&E`.p- f0h~ζaw lK_w*$T(lRFRT\j9 [$o|<WF?g#`=q {u76^3WNz, v1y y!'43I,)Dbu71H9\|> -VpċjZDtGmF^V#wY=ٽnnިFV[|jJ61J{!&c4I*ɑ#9wF{#̡yr3s̪jBASUYl.g&&_ZzE0_P?Jva{,.\eDxI2,|X(v #cy6o9H|Dt4 2Yn#<#h*ZI#:;>9u:. ׇ&$o/ؖrf/hq5̶_yegU`E:+kQuhfZʊbZt G + [acOaO=k5=dYF8`m0[R yc,|E -AC >[=KٛZIӼ#dnK8AKȺNߵ"+rq_xq?q zMVQ@[`Lp]qNŢw0%13L!p؈4VaV{uHY5L!3BwmjF+3Q~. 7>kt)P0=A$us.Y 45U4}̤}FP /`u@¾] c'! 5Wɷ9HCp7+fJ),(^5 !@Bj_:aФ%m:1CcX:`Hf.U QުǀZMGOݯ8-3-KڶFOwGRϒ^y!WgN+G8%NQv@qc^ wuT⽍b%mv'%GdjdV kY|r EZ[^HKmάByJ@|\JLWO$IIv굶'w8wZT3/=*=U%Zc7Fw z/M4}]u3Gtdƒm59ETO6YQJ A ؕ49SȞٖQ}&_`` ʾ:(Hl֥7&3nr^\|"baGR"d53+mIZ+F, fyj"Y*_=]U"~ʴck">eeS E`Od>{6۷I:Z~"khl-z;Pc+E[X;Gs{f54fJݪEU .l][}َǰǗ\)SjY|C;~A`сEZ~Z؂dxeǬѼ° =iOٴ! T"M ,zPݞk[Tov^6'IV^+YP*ZeXLӡz{kphY0/}ɐ4f|itZ=3l3PmR-B͝y ƑdBf)'QNbR# *<pɵkp$B 6dryC Z>F(4*-mՐ6zU`5էDͣk5UyP_T؉曕7/5&U}pyKܷKeL)G7G+eorIU&ji@,yE1i?*(K+:9r)ln FVvˉ=lߊ5aU_0$̆QxfTD!1P#UĨkOBJmxeEhٵ_+٢jVAp]>uIexUd𚂉# WE3i+Lf=&f ڪu jbUꞠY L6WYCM V~1T@LNh?*${a!2@)iHRǤvȂxj"IC8j GԔJ]Y7#GP+('v%uσr<W MB?u8Ѩx $?3s۴\3PLm)}E:z^'mƶ$GK 7u8kY;bv{v=Wynx+fkA ҧeh0/ʶGm-s&0f2^cM#>E[zG"Ym5|g YooZndΥ![SbyYԘ7@lyӃoS&q\IFEiYކT.{b+["n"9G!Y')AWF |#da!d̰! #ecB&nYֽ' J? ;|\0ҟ*u|~Q/֭hk*o@]PM5-U_bzѬbB:ܱ)uX[&0Aۛˮ+$+3{ ;VqW[ڦs}H)6ń/q~&kuS>,P,RKre6qsAĒ rDm-o'VVb=V˲|L_6GR?)5벖Idm+akB;َCؽWלjVk7ȺR  6|0A>,@3S1:pPY!&1AV8nV*:$e&9-L`aKCZGbݑ~=Li?䄎Gο<::w8a>:m"^'Φ7\pݳ@zG<<7ƗKb O+p#|{⍮!& &j Cr?eϝʺ +jymZ&l|=&JݞOXÞD4R0W L)".\a60qG"xOFt.۪,<ݨ/[9x|ķzta>c* (z(pKO`U@w·e{Ճq>c4.Yydm{eC_2k!OzSQJl{z=')6޴Ye~Uڠ-7[̌^'O5~ά\ZBؽaDV'&2$:oF4iw72;ɇKGe5?7@0?ӕ?|ޤpd$9k$c4Y M1A ) oU4ũ iɚ,gLi¾u"OS]M3*y*1Q5l~;y_ue<`CiRfx813kljc>&";^xN ݎ2m9_f"{nowF[ɯv{噠fMS!Eg]"|-۝]nvxưZf1dB@U!JQfc9 GglIw}Ҳq\J5E9&JL}lǨ?e3jI#a{"8 y_ Y$xatk$ `mFj] }YaUa,yp!7|ghY Sف"m_))4Bi.GF?G{ZV zj)'kP? J.$d#y*Fި͵%YQ?+N Q+SK5j9O-I:_*0B6 WAp YIpûD>Y(^/02ߨBo6$heZ6K|r$B nCc ngx-HHFȅ7e-<+v K@$Z&kKgk"`,mL -~WগpnPTQ=%PV'V!x`ƷJԜͬ&LNTItyvZ(:~WX6SO7} g/ܮ+@]{[7KZ?S-MY+R7QF[ G]^sQ4_isJեɯgH#ɤU):v eO݈g\d`LȧHcR,up[HNWQmJ,` 6lo`BhogէLJ*hYcF8>XI/Gn2ة5lگ&CZTƄTh2|zeMl*ɷF<4qpv&3 uL a#8Ý{mp'r!'yr~ Ó;'%eɟ“Ò n>|"W)*>z 3C|Y,9<| 2z.wptj;h} $QvҋQ*0ZdZcGTK.AT_.15cXxvfgX.VE‹ƺ˥]Y>WAk#kyc~Ck~Y)M]-S;ך=AU;/u?|jb *.Pnhk{]hw(Z˜я5(8q}t-fOk${,V=r do aE>~??\}jDV<@H{{=Ȃ L\ڴ%͇`Bx+YnDNFd`)U~ b)hN^b;rtGB9hͯ:oKaVz~~c@_2'^Y[\/4] WS~VU<$EK,@RJ5Z,V# # H/:sZF077zy,YfgμHz-l{~CxpN/qm%0C]6 ^.p*I!E JÎaFOaߛhG4ĄHE'5&Ef`<@*b>Y/%Kq_ndƢ gTb6Oz6i?K1SX&0ٺc-_j7[}c׶bҞ ['Ml/s*<(}0MR3%%F;B1_MY?c78bSH,MQiTbm _l|?yx3X@ o jl"b.d+gہ%L"(sdۚdI"#^\OzvC)rIĠp\ʕhNc6Tv6!<"Zͮ3aHL3e8𖶭1 .|"'=-o5Tlq.wcޡ癠Y f0R>;a^[u~qY Y)T#*zhP$ "4:XjY^y5bDVBɸӎNW\p0yHuphA4r.L1jG+s{ %mL-*XuHZh{ r{ Q͒U2̀^*_w˒ګ]RU\@*G^Gڻ%u_ ˃ѿ0ćPOνG(~H$i$Q8ad9](γ";UìAy,A,l/%G} _ ?o'HF, =륤A20w㯀R!aJn*ib CTìgg8%SNضY{^G6355M|&]-[${qT:k2Yr@>ͯۺȲb,o"ΒT|%]x5yG_4C8H,H jߖ=L XU~2"ӳeG!_e%>YotJ DU4eHaMͯQt@xJo*͙ǎŏ0?/{}kzl Fh v|1=;:Z}NSzn^Js'F`OK\=\ibQ =B6sUFwP@61r q BJBYcq\#";JОHJ$[gDĎ=zH߭'(,zWc8T;ᴈy\W' BMEcS]L:YXzԥk$ fRa,lchQ$@t\V; w{ F޽ rWsKO$Ɔջ47+Dr )=a~%fca"6^\Kwph[I9gw]Jk!a"dEm{4[g苅l~TU]t4vBZ>`hUGz65}0:a뒯{kbr )Ӗx}w.Zx|KM l(;"n\f52[Nf_CY_aޗ|-g3;c7Z3uZ)j+њT:*NP]GU*ֈGVIUҋyكn;ye(6}Qy_PBk*OOɨGGtgN%IGj15Aqڬo2*O l覓#Tz5G@H[KcC"zߝ,*2g~%r-HpTE;u nDoqH׿SahNS5^VUUiXгpKqE6i1J]~TTP@dށ!u]&}uͭo8iIt|۶\bXVYcuR1"׬ꏒE,H%pgW|35kØXa{Y6J ʓtYݮ7ט@$_[zOh-iA'{F2䤺=xmJ=S욙Y %ٱb!= Tŭ 4d=9s86/zw uM*t&`GVdIoF0rZC4 Fg^m:2Xc({<|nXoN;ߢͩ<Sٻ1.|o_. ߠӳŔpdas+e(%3IE?iS 97hf<̃;#X;[AxREF3aܠ_a8p^ZTr9uxrRzdlw2gL߉;q̢n`ϭ gC7Q:j@0zTM9@9fu:LMqf~Lt<aMopTVm;T!d7PY"5YxIG9VXF6O@~Z[[^3>?niG?7,6anO1q@xx=Vr2FAkl{?=xJ*8ŨB%7o4S.$4FeLSOS׫%('^Wx*mCp<Ø1q$J]zwɠ*^4I۔q7~H }_\M/_M5[MP4# @ҰH-Z"*t4Ko3/34%ɒ܆}y:f/L^VW7lP$cgi YD# ^oY03 ")fWmS` ζYTRD=!5@]Tu%,:4&(X8590%@O1wE"K)PjZG˖O 1gwިHL;~hQXG܊YϟEhAgg`{;AjznM#PsuV|DSIpC ~dHO[;hcKi-Gĩt廟a+Gb\VzQQn炞6@sCgp=a r8>'Q:cدmqGlD3n*߯$zwGWO_Jn-:k~;.#U9lmRzkd,fXTC}7P#/h!H[`G(4X++|rҖ}J%k๏MSCK "i|X>^B {AN^GiT 'OD !**zi@H _OCA"%> =1M2xf`zUsi9(9әP$t-*"_~'$5CTh0D=S~>r S:|A 5);ёݡ.ʧ^&2' |j KOŲeGؘ /j-,J%d=4I|r>@jl*Ơ9+ƺW= aRZ~=5F Tq+m60S-I򫼖Ԅ q0b4-n'(7*_#JF[fVQX^SbAy3 }/օTAS )LW%xɂr3A WV*(Wcf5Т2?u+Q2|LYݎ~UNM4MwP.]Pyq*> #~zzAp7Uʨ\ʊFVSٗǵZp)c(ۿ-I</*ROxFm-j tQTzgNRf3ڿT:#xZg}p1xL&)-RTyOuҏ&ql0W']'){腩RNOWޅ 6,Ԭ"K;ղWO~қ!7878H|![Z6RĩBf ؅=ns؆ڠfe'xpo*;ȇrTYVʄ,9v٩Tҡ5m,<# |jhST{;n" 5 1$XQ*lԬ,+}o%OъCwB=ڟ_+}KQmn4&󼳪kɜYr[W0Xnm\-rBH LK U'L0WiEK0|.{v&+hˇ@KXt5OgB~+xΈ񩋐ZHແQӈɦ`CEZjVtRMi Q+h:%j^Y`8P'5!u^tEX^+Z %.+jy?ܚ 2=ZM!V>6莖;D6[Tz5X]}YaE%*U5"zK-{BV߁kb 7;9.JBSËm}%]jI#{BW?yUR^8t7'"|TК!t&qvH9F8Y{7ǰ,ח@0 (&wF.M>k[f ﴁ6m`5gwTX$>ljbQ_їqņ g@ ˍw gWǗRJw"J_Jߢtli9vog4Lu5#ySS?&JX77 5ε bT0Q8 `'y"IjkzuOQf=]X)o]}v OrMA;\')U:B48OŸ0v)gE/虿\Wg DŽبc˔honqe9cں s-y ' \U&0`,!qYE6hȠ=:aSJE!U &/d]8fC~ϕl9!Ʌ2[t,AMYdI-æ#' 5tƎ'TțVHg9?oB B8txf`1[ql*rӕVǺɂ6T.r_INba:у)>ZP3D$Vڢ<,~@њΞ dȝd=cSwu D f(CjU p)hwTW4&D5FBdZ6iRDd$S`d[ @Q!;V#wL)]4=&gv)E2}FZԾSD՛yaW]u=™ݿC&-nPj%rJfFăGLJ{ ot$5G#)C]Mmӳ#+,&lf - Y66)ˌ!Z.`n!m!DAHaӼ9}[S8:tiXl2+!Ȏr{ӊȬ0+y~/KЙ5~5i*J=׶C >b5Xkٺ@&ɋǗ#eq@dZnǙBc$.2˛6..%D]%ϖ2Ac} B՞.hNgTxqV}/(Nq 3gN7ki jTqv_oxެUw-t#kR'زi$8:1LhoFۖnE#'oQd͸uhBl[>1)[ )}*K\뉇UFvKHךGLYFsEo֖v.NnSN|Cu^k OK.Oр'!i^3ȾfZ@S注-y@;7g6]| iگld1&XjakW(qWBFt6!T-3MyҐcgE!Qϲth6?rOi؇HKt )#HےK6~uV"}*W<)!. })s!e30uGv')IeU^a fw-qq49sq-gRaL?7~ɁV?R"qװAr4:n(`jI[%`"ϛX*j1X,n`m2bx{nG)eKǰӿChk kj҂YOOs@A6Tɥ hc\19Y$,9fP VmcHJ e953Y0sUiߧYQEҪ8+WˠiEX/hn!o8u ŝWQcB`T>HymmW$7$ {BH!bPBFw4SMڞyϘ-0 CM&Z0 نy+Wh77Ձ~nJ3/!RXK,4%ـʆ楥#]q]Y+$`5mStup,d^˯UIM,̱ף䫟K(V-1EڴdYri.,b:PV}bPLi2$ϥv &4\[ݍgTG_ّչ,v9^\ ~؞c-U;^9ռhMjay,ܓ0E1Μ ^ONY!&`M.^B\# oUy, y*G3u3 k}kH>$zLNt^\ADv-M#BWrYOYKUn Am{eڙN̍V$7ޔ͐YKT/ab`n?bE Yc󛶤*tc2%KܼJӧ@6ʈd=N\54J89>VJ/1sWEwuP,Mzj`> "#>#\}|3 ko,6?Mj;`ջ|2z᮴I5)# L  KQ8Xkj +,rA4(|b;L7w{CSشpMz.WֆCguOU]>n3I`"WUUߤ,}#KRcxn {k[>({ rV Qz` v쑆|U3t(uZugIt>[i0Hny"N<Vj@k'=C3-Du_w_cf2xӵdA헅&$+TѢlp{(!rHRH$jʹ|B 8}T9MiS`' <݉M{30E}hc(ӳX}_v̖|tda5L XPeH3xlᒵXمZqk+_y˨ =#곿yN\{Ch&}5JE qLhX<2zr&ȭ{In%wi[GtY 7Y.m,/$VX ^(|Ż]??_%w x:oیxWDB5尵h^dOmqso?7nii;5=sCh@v v=0X>."fdXI‡#RUM\ Ϯi#A88!d.Uf~3؁3DKȡc{,mnIoܜbN! rS跇*pjn?VvZ5[Z5r/٠8rBE3 jUVimwm{NGX8)ýi>1uUG=/"K4-%"G, R{,+W"^(330iz'Q4%]|2{Z3s838sAyX OPfofҨZWD蝫cKRRkB¨bټ9de &'O0#j9z4һsּRmÙ7} Ұi3A; TP Ej8YKC!M>Vv*$Yyf)9]$^i*zuzx縼b[g+׷p|]88ywqL|xR<-(/g+[_8Q|)_g:B3 'f~a5l˝a.geu'&.=QS|X^" /!C//?nFws j+'K W?XgFSqi;Q(?{ѷ["SKEv8^uO:Il4A{}15Bؗ9W@̸^圬G6{Eb.)QiP&a<. +bv}ikK4`Y`*{c]x.M9kY#:YHO3&Ox;v~v]v[[O/ ZnRqkPxbwc6|;^]W7l8LJxu斧vQ#PZdyN-G+ 6iJ>Q?H"̂e/]F5U,`5UG3uϼJr{/+[^5@alBif|=m|Oh QZo7k]|.!DO:6ٮ_9[3 ڲUg%zLyh,`| V-C\i]cQCh4 k|9k@&f@.#J]$YYBe*JY;ҧ;ig֤ZsK^:a1l3g'"F# Ͻ=L(W.,ӥRe\Vk"G#r 1V2z@Wr@ymTs)<N'[m_ac('QuLQ/fկ1i0A+(Xd f\K\?5,nK]X W7tS mBOl'^*6.㢪VDП\u~>LDsXJYK#۾qdm*G|6w#圁,)컛sr6+~AYHSbw%f@})懔zn߆tl0]8dyI ҳLӁ ?Ҟ߃ͱ_#iz Rm+_|D54 gױ!MS±Ld80BZdkXJf's}4(Cgh+-cj7U' ;9d5.f9 rh&=td+0ŶCTOZ ^Au?U 9m,i a6mZk#mij[d7ހՊ=fNz^̉/~АWj۾z(`Vxvgke_܉F OJĦ46JWd [Q`xwx + b}Z1s=w ذrl%6K<_܍k2¯ 񾣄ŕ5aUxHT \TqKs vનD2S2IjGK)mO4\_llNSyAjGI[K/jA |bP9[ Sq@Cm`c᯽EUa&Ga]r)ޱ"XIR J,tZcwZTaz3W̎J-Z|-,3Lgtn oˎ<4er)IlB`&24OR;cpU6_%9r$9W)禙Հ4hRP&s1UcbdSk=] j^ +VEcdi8A{9RhJtXFqZ*Xx2ӳt ʳ0[y0_v*9;qj;A7nJudYp"Dg`vf6Xl2B ؝ X3@Ƶ6=P6m2*.9w_Lέ^jjJ.o6Ͷzfa7>57%PNFN ]v?{'YVBy[^؛_mzRgGOr D5UP#ٵPJhXMnҍ0C{.YU߭WA bZ1@4'^M>fuEF<=͗OY7nu35#<*άc?$%P2tBo 1ȊRhKF094(LۺRMlgΫ/[NSK8܁Eu>eKۤyQ悁hO2>ڪ̒L~bA(IkznتH|os$zfO7ŀe XuғfQ{O.Z1mi=n3g%[$~AXS jTA]4eztX6G|g<(DY?SJ6+HhIjR@IYV2aNZkt=imfQ:)YYq/'}ܵ-~|z.gq&g<ZHJtYOzT{[et]0J@R}_$ NqP%LrAV(ht[@.$[͋Jì,Hq;m񠽒C6h ,fkz;Sg7 2bڰHaD'KnJ嘧._V  Jjr?zܿoEz ܋ N-#q%w=*h^u\?'=şiGI zC,j T:o̠ȸ/*fЖ-JC"㺑ywM0%VB}o/H'g9F X@a|-cC ><|e yFZGҝAZ즻k_8)>g347Ճ:`Wi9Uo4U JBݽRB`YYms)I+lHkӣO >  dy;V`dlz93 IQxOFq)yҏxR5jB )s|;PR#"'Bœ_oڐ?:Ir $6ݏ{2YO!}L{bԬ/ȔRԘ#Lfjksf#]e2ާ?zj%x'k,\/E/E'VX'$OE]/m=*du8Rk]H,j;65g}%WE`>oޞ^=JSwݖA+cER=OAJWDlVL zQ/48cxhIrr3$|.T&e1wܳy:u6u<FC@L^$ZZ}g3{lTR7WR*n޺"3q^4e }֙LESqf:?HKl2tHq}^t T{ 5S j0?)%4Ef{P,x"DZ"[Z$(-OFG荎SiTrA $naF iZ@MSoÑ@V@yJؒcԂkzFC/=WZWqsvwH~.Ww.rVEfx2E^y,z-ZRk EZC!CLZ՜^e'JLPU$/ޔ-C$/=25c~ֵ7߂L d+qH&W?>r=Hཎ! -"<^ A=X9Ɲ.H LT#eQG5e/6'O px@~%zCFSMe)9Y 'Z r5LQK[~dd2Oe2O+&~di~~c >fC3wف6&D.WP2fYW8ܳŵ:Ӕcۺ=fz!oT@,^UZakal!ٌws+%?&%h:Py6i{-ׅu%fp:ʢAZܲ>܇x:UChM,C/)؃ҁ0\e+ įH;< bUMax?^-v. 1 gý 9a-l[1[ z }mQoN~#3 f꧍Kz "AX mi={pBXj CkI傮F h1#Ժʺ6̷8 D,]-ˮ[i L+6KJ'Sa7{:ۗe,ovC+ӂ߻|hEU>SF 2{]D[RRǔ3zf{5=L?|RT$*>rpX|e_bUvb )];fg]{-(p< ߈Svyhe1#׃tԎpLZ%Xjذ|c% :~g(8zAȥ8d1EKF=s );|S |eE[IDc2YUR$6E#qV`m_=r\{ 16g!G!dʑaˎp\\]Z!FJ|%0u&= :Ic'Ĺ~ոD 9`xCI4+D-Qfek:g*96J;k~jnM+0,! Vĺ`;yr b1fZsD4?7nL|d(Rnu.l4}TP*r=h/,_Zӧ7"eqRb)pR0Rhkr9qc{VM1Y%Y >"I))6y (ehofiʃ^J|?m&|m/nҳT{J]PΙcQa,S7Jh<gVhJj2&+mi͂8ekjb#Urޯtj*/ȜTIh LT{I} $U(x![aS>i ]tز#62˦~e~e?![*Ī%xQ6H##ʧCY_WIիm=-|Oݲf In582.uAcH' !0S*}wcT$p|ixR-Xf" W)];4j]{-}԰1+Fp*W-{ɀu^0Gɢ~u?=*>{3Z7廓tdAɜoYk( _d(d(sjs~UەBE e| %,#J϶(YZY$ sF&Ci1ڞVJ}:J'|ɶcDàL:XH վ5NJK.t_*e;L?1##hiJ/ce ďq#ƄfL&S VurS1e^@Mχ! H[ N)_ԁ^ѲGF$#/ eDZc.3" !.E9Qz~e2 {qyϐmpa[%wq+/yQxWF^VG]BϺk*=[>&q=x~T7h:~ 0fzK nuR<]\ːf,F>6mV6^ DPD<50c\zl;;7E_eOiy+>1hQ$אkn,s8Ngvxf<*`#3]EV<.狣RyLlIg] hM9OQn2JjB'pڻҒ=wr!'923.c?ǿQǿfco ko1is7 &E:~ uj~|ԓ>(OuT~<^B*^?YN[Z2]"mʧ%ei=[bKO > [[m(2r%: yyX='DjO xR Ӭv{}3k Ҭ%,T/v6Ml?D똾| d) F k^z΅{T,'-Lc=pcS!N\B ƒf[FXg ^ǁm}m3Mby/+T=8@HeP [B$廦 (+/e$SXf}sR,]3v}vz-V%!OجX^B9-2v~pv=?|: !Gװoiu枤4><.C؉x>Nڅ7Fy&V>mb ٪#f<L8S0mNѽ5K_7 Nv[7ޱQcacB}G->l(JQ&JƋ4Z:Ig[3(M[L۹ڊg<_[gN-+ g]x{-| ݬ<. -ӗn݃iU ܆Cd12Oo}1čGx[@|d=abWqkYwCOH*jЬJ<2\?I$t2n 6V,$9hF$KjXBtRMoWfd aT(zŰGx6ҺeW4Ij(FE z"VU*j4a McZ%[,?-G(Ҳؗ{Of; NlAoqL\s:'m >V.cizj6`VDOc=cЧ>YA\8(g%>ֹYf!+oEfo2Iq8=l̀W%$yl^Z8!:e`)Ԓ2bV?`f"EIpK/6gk;\rxBE-Fj {.y= )6VGy Ρ\{F.S[c+2$@f3 :nmJڀ\$1ћ#-[MIJxqڷrI8PՔ C%!]嬷2j%ۗx~e3ZPO@)(SSY pXMh\D=&0(ԋi0WZo_ƭZOZrϦB7#X1jkP˸+ǩvPxH+T&pfkz+2L m`s,흤z΂"t|b/]S@RKc+ܝ*;&)FZ1>1w_׆ힸbNXl8>j>!in _+u=& #Zګ;f\41Jj^ӲA48+`0pՄ̽K#fˆQI}紏lebVDfKi=4oAA2 \<ЊLJcp9qUׂ:IeNbٟϡ{f֮Mw>L{ڏuMP`?GoX؊F8Gu փOݻg%eV6@"kz,5R T[3e-U*s57 J9 NR@x.XE怮)-)rК";IB #bDۼ8TPrեCkRFrFr|p7Պr(95c \=7F34~̀(4z`{Չ|`.=PB&?R#,=VP">]S"+J%!f~["ObV@z7}"/600qFew>CMr%Pm6]$kfD:'dL剷=p/V)8ZqK(up.T(͑#ֱE"7l}yp;?tr6}z^cs) ߷ÅƖ4_Z.I%I٦ A&;HHDE4{%+دܸ$)t26I~WA4dbrAF ٽ~_䱘є?~3aI>yTn`K਋˄=MݳMl `&j5t:(jTߦB\u}~ƚ73xq-pih 2eO ;WwKqKl_zGտOR˰ {܍MFպ2^DƱ{.Yc"b#3'V('ՙH/(XiƘݛ|M\3WqU՛]/{IL*NMZݴ>uQqb#5WVܚ\"l;-%RAd0} W"lE=QƛQ@f[ C뿼:zJg0 n"r3ƈ+ :&w]E:==+R~'^ē wͅjQ(m6Y(x1KyZP2Ȥmp:m]v&Zp7K usa"ܼc32}q¢U;q`W0Nwȸ?"ss[\vlv}). [UbDAa=֥LJ~^^xNqQgoF)M9SoN(^OlH^mxm3@f+mi䨖3S|)P qCF4fmܕM送L*av/obJ]zPr=H\9S(&j"ֺ|ٹlT{, 9Zz>cf%CpCQ4!F-VE6gr11'1Yb(6hwxÏx Qcϒ目ߙjL8Vp\ G1"#Qi$wPxb )RiqcN쳿ZgT} SքK/bN)¤ .isQ$TrEVis˺a'R^_H(eW^Oś7ܮwD g{@rV;FOR{VjvG- mR.lG>Hnfo`Xhb{_10ǑDd6qPtbu.gxr~:!t܁#Ԗp5FLH"JZ[5s{66BU[͢F:dbԾ/(j!BP1[/Uv2Tq3͹Tiyy#)]ljIJ$A?1i}GoTZ*t_J~6boI,esM*)F$@&yq }rzC&9T)I'gT_2b;A.ing>h˞iKKX-9J\Vj`ؒղt^Z"U{Y,jڮ[vtGRAIwxa†! TywBV3Z5D»ian@wo1,,F2(=Xmy ԧ@a†>@s`bܸ-'e]rzBsY f_K%jAXIMGY]>͡g8; ܡҼ!Rdrś,Rqu2u]>d ӊFn1b hQ7z#5PjmW`<>My3ܨ<1|u,kp@3Ѷ QTbk!;f PoǭnS|U⿯O @^jΈK|%J|Hv_p{v=WyB5qo6?jP_Ye}ú^ 4gfҟ$(БKr"~ʲ%zZm9f2@j#0H*Ӌ S܂u;nA<:[8B5^k/foÆOOEj]Y ]뿗 ]93ln\B5+/ a`;bC38Ciohv:r*=!|a7e;]5R`W6PܼHw4И^p,.*pz4Kb>A|=Io,Z~]DI(,yCY\څ:cs` 5/.ΓnZ=A8Vp4 zI2C= N!zL̅j9u0/H'UeBp"v/$I@b_3ܣk=2t'*36wr0'hUO$^pR 3svhKWXHoOotGcqNs -fS4ٲw+T`OM/d|<}0bW_S|%@XN8> |L_%$W8ϼQlJIrZx*ᩎ %RJa *bB6=q:vCa3@X+VfPUH K(Uڡ*m=@~SpmOe lSf7v^e_nWuW6zP9a&bbBHҌwvtJ# g=tVe#?evs3ߍ s&uX-4 oQRntDѢsKvJɭ; OjS=oj&? DGidBpΐko$7sz꺯⣂8*ѕ[0F<\ d|-=Z>nz g Ch9-MC?{^*orp|3m6ٗ:i.#f5rI5bӢ惚w[ui^]7# 3ڍ>B_y@XaCq5ղ4j?Xa"!f|̹U?>쁓Z~"4w9lmS  q2&1*\rTU6tPxq]pX7>cce_#@]+@2ES@:S0ftsN`Ox_W7oz2ЩيԸ-ʹ($5h}% jw?C= ^bA;Swzl=N s,v]' /if{2Q,8ּ63w3aL_ғ*_ p-tD`Orܪ|" Z?Ⱥ{Y;(>ʚS>uhZQe۩FCaC5* )NB|= N!@~Fkuv5wRPk1k4iPi=C Y^.07v-:uz꺯rv$Ō?њB3&#c.!H{jcoҪ*ή -NĖuJjɭ;D2)07S5~Q'{U%2 Kf?+,eY.K{܃B[4#{a3 RE,sjMQeӿ1ë- ٰ+`sFngTZ7~/ f~_> }ʈ8 זS[Fayw%PMn2oţ/l6&VGBdPpvif^Ս$L_OvQwIQ2KEsrlmuu xJqŨn. uvKW'iW8+iЬІl˼">ӺJ{]jt_mMmRGݛ12.u>"RCiHnmHj=KC;hK#g?YUęŝI{lH8n]{ܙ/wc~ko{c+ψ(szoCO5OFEJ,'Jy,XW?B)]b-]d Y$\>h/,;iX p̔I@ J9ccT ShnmQT pT} >l`zM}PU endstream endobj 167 0 obj << /Filter [/FlateDecode] /Length 39140 >> stream HW[9)t $1 {͌HR giP3*V2:Z9k3o~櫌yuQUU~R\NڸL\|o kGrn3*No?r;kV?7p-ui>=$E2 ngg/kצ?/'r |lQDE=f_oIo $Z`Uג.o^»!/fiR`H-pts$Y›ZdQw>KqZkhf?^u߳)/6肖Ibp1'dnM)Dndda NTPlr<}XY@Gi rj w^Hk$H~ XpR;1 B$?^HLjWYDw}wbE *'9c\SྞP 9 {*`T7p[z:֘ Pשg)i_M|92|TO̙$47-:EUΖƎVZTx 4ĉ=# j 3z`؟/K{]j˺+>=EZ N;K^_0X5(oY6l` zb0 $tc)(,W4uQ5 F`=c^\E-z\RiA-ԁ`G <6H|!!)s͂vZ6/{*f2%ǀ= ]gPT|e.wXZM]ِy,p['aiRKr΅/NB%ߠr' \+'CVO2ɭO!RWݳ WRN]w!Xh[jeʷ l"> z9O˰9bH_f+4~ۥ1O1Xu࿒Ur̪òxaѾ'[.k뷟SW589H+~T!u%XCa"FAT.ʣ(/c`u5a1ΈPG9 &k)5j>G&EXE RkPTt3'#ٚkwB1; 24-YPj}S f=jD ?Z0x`mAsDT)<:>D^v3qg] `ʳcfZk;:GT=F?l;ePgzp5CP1mpn@3ZDl'}. `y `w@iU>giV>$?UҌ9QK'%\嵻B%,t|ϸ|C Wf{/9?ӆ? 46+c7zx}|)$<ʾf;?#X Sl|Td# sp=1Ɛ }*f oOZoZo}@뻅B$X7qS'ҩ>LVA&LLi@G8@idRp&]#2ֹ]p+N Z~w}L@@k(q'$*-FL$M_jcϱ.?cƤjA} C Bx Yuj%*hۇ2wUٵ0цt5\@b69qL-=)wrCo{pNPbY Tj@0hj`.5]d#Ug1)wxlm/l|tī[ CLL4 M WNRƺ6(eI !3!0.6)kp˺->=!ѹamDhv/ ,x6pȉT=H_E^0!2lPCbU> ȽUh-E4熬62|x\ ee 64]'ط@~^kDBp=yLq!p sŬuL]MiH%U'cp1xeߙ׷ ˅&sNYA.qB]jp9r) ]\n4_@[~rB4,=SغڧrI巠>L3 k|ٶ^ŭ8T'%ׇz^4%#Ss 81Li4_0duWI$=f׿G=_yħG._h0XY1v0Uzӵ^x<qz:ymtI_JJeV%2Ԟ,xkK%MOֈǝ7 u1 %dɂAN@g`BHSgVފ<ڶj1le~q`/zى}T[PX|6_UY\ԀBF؋kS{{)>ZF,?BH^OFцrڢ3&[d;Mqt0y;}eQi֎MW;TYxk.EI쇺;áZCC( zE:;wݮn9~[sG L/hזvV Rj3 m]\>1 1>c' eܥF f0 t>Ot" o2_0m>>8j䖷"X淩ؗ"=XTڀ{IqkusbX!XcZǚ>Eݬ2Z-J[Ϭq"mY͒5_TR7S*r᪤Tܺu,`3=[}HeW )Nw=駄:^{q7gR1fQ=bobCmPdofG .Zb\T757[;K#GbX0pqپ<#j ٵU1vjqh&mF~)a/#KSV)&Ea>nh`KaS=$Q4U ,pg[eyfDlYLFQ T[3E5*~ M^p& d N+#U1!󌛌6Iqì.1ū̞{ ocŔ *55Ujԧ* |7%GNݞmb\SN^<;Q,o=8WeҔuvi\e dW]06tʸ9"S&6+Eh>IL#ךF~MS|jԑ)\4ƃdg2Hn2z"HO(3icir\ıOV]$*CϮrʑ&]$g@I N t->݋IߖukכBޯz߻Z1-VkG@`s1n34s=&dʁޗPtJM|>qvxY80db}:/>4h@N0y $ouP|,G +5,#2 zí 9%4$&$<4pZsaiUl\^Gu},]^k`G#׾ֆmJxt)0.d{!lghc1NLT Aeh}TfA7l^wևK==黏 4l4F6Vˢm(gUn]Lz;@cé hMpVTfO %G7?9?r$Gߥ@$H])℈RuK#-MD24=ZR87IAIm3OwasFyw>Cэ 9YtA\֟5KAMw\zMQbVngvDcʮ"ʑ*(ʌ͜+0 ^ɪY#RC g;}J{:c~ֵ77A3}B:/'ܵ 3HGu ,6-ų洞S ~qC<|lIj1s*>0P+~^pEېB>䛾['/8(eiq"E+[ fE=`S|I@+CT3Ym9q !$flvikQz_iٌ"}R5 j% uE?]̈́ɷї~jnʞ;m-:>6۞c>mLmkhUzE.N3͹Vf|m [jGkI|vl>k )f§*=7X5#$k8KTTi#ȗ)phɔPpY kFs|zr{ [;aL UvjH3Yzh/z2[F;Lwb LL6Ք.e_GFJ<βs}w}lbQ-ՄYK7bՒ%7n>E_O-aijfl)~idR\:>WGI~]IzAvChϡ/{m3su]rw>罹?fk_]׫w| w]I]]+pc<ux;ky!X5MLkơM"_đ|7ϖ~7=o7/v'|i;mݦ5O?Kyt3f6#3AqjД͐~bk']kvnׯӪ[ݣd'K+]wE`]t_|v#Ӯy B_AC054=M/'t_oNC "5yM(7.q+yqe'صz{@>R(|xx<1!~@"} {(K)z45uumܛƦ@$"fo)Ceu i9ܺ}3a::F/- '1WםӖ19% Ac~׍{ /;8m}5"ۨfV5O1(~ ; BQT Y9\qs Pr[M (zaA>Yc(iN2d*A=JfTWoZ]'=$VGVށ>ɧBO;M (x:mC_s8MH%Ԏ8.K)9,^c}01a_qB v5Iė$ ^{!m|RF HuP2:pnIRڗ3K ʤa6_ <;5mV*Zqk(AL 1+95 /kCٯDt?9L*$yԨ)t]+T`Y?l[upSoD>v]*PRl:ōpۡ'kC⭌Eb0qb\yˀI02,eX⇙xbgxW񊎶ƸEUF31f!d=c6Ye[hR,j!89Ϭ̩8G@n0+{-]oD8p:6f[L~GTkЭ㱃ڠ6 wٟBN. *?~ ֪Zi3WzާޯPc3f ;Yc߭ϭfV8U鯠U=N eZaiW*x≍J24|DQLvTkGcջ: @==kG`}1OlL_f|8 ;9"K1 nIfqDYg1C9x&ܳ5duO="q:'f#-ϩR1'ukUIlC:,9kɖQ7n| 7ћLjc~pMH-,5$ =>Juo I“`I?8cJIHARb͔|ÐfI.U\q:/~܇ v&s9*ީ DĵHce%y=Jdo$@L"Z([jhoIf +'iA0^+-IkY@ sH a<:26HW4ҾLs&ߦy?َzs?s8N8ƙ!hØm)99|m&&)#nQֳ4@T}Gv{NdU.$*T*=KPytTrbٽڔIgD-| ,m\gׄVK'bA.ى'B;Wzߴ2+)M+4QDz Kz5鞲|օ;6g;J0 ({"+Jh-1q[# o OƓVt t @xHn/:a#S]vH= ;'Iݧa9vtzJϩA o~~KK`_4 i}hBu Nl5 աjTC.,9%k~pD5ĦS%y Crn81'ŷ&:n༽p;ց/fՃ3GWGrl.xm3@A2,ᶂK9C^НO ' #ām3ڎ ;<|TeW:µQ@GI%ى q!挋6q, ш^Ňdey3 63vWkLs-I/63J#6PSʤe:z qBf4CkU>;6I$[U4*9'GvǠ ۰XiFm_gE^m SǷo{q~JKT~F+/RpN0*/(܋W3ݨ9g?IpK+P4Y^\K 0г `xgg%8bkI'd+IsiJl_74xSYI$R)x*ܪ5Hak-GfjcҿURmɪEjy|3F.?Ehl/-ruXo:I@mi|hs1ʜ쪄MW}c\Ezl!@_pMijQ+Kw"$} pCr"I>n j_F9ݫzZ M8EOp7 DZ_)QpTͥ1WVS-kh`vBF6, l(_ iOQ Q3b=T3sWj4a=[Ъ;to96o L'7h"Ƒq {؆κFAQ>12?ide'tFVO(R?PQnAH<9(͊FVkWpK]mW*vL8Akz+:I ~-I^weXU ꁅ`GBTlPV<½UG11bz [Bm_!VU<Up F&Qkѷ _L=% {% yv>9eyVQ"Ɨ_ mJA0*{71{"^Eo,4S;fҿ~ oo!8yH8At'`PC r8r<$Rc0I_ב:K9>-d4j;gb}ƀAJ8Uc9tT(R&l>VgVE8z eZkHu2ܪ\\yYH*DR75+RAT9hlRv 5˗lH4_q6g˳򲍕}a찞;FFb(3y:%nJeBJϿ:VR~) I.99$h1?*xS8&Z:ME9hem! ܠԛhξ?e/ӷ͆ٗҗ?ʟq& 9!ˍG=&EUW} _@~dp>Ooj@-ʓ&1 e2*•a,UG:֑^Bq?"߁t|"vׇiE\HNWdZ=O]3 fphm* z=xi|7m x1kyϔ:OM'<(Feú`n}^D-dN)ou6^?}LGpgRK>'}:kw>oxZԐJQSwGBMǁh- Thx-'fҵwváGcʔ9Veu6@c]-"q.$j\p>'\tF@ÿW*(>a/(wx+y(h[HseӭÈ܋K[^]o=uZkSo)yGA[q䑑y慓GkLP`a6Ӯmlf߱͜Xj3翶cyi 5Lj߄9XTuĶ24}p؝!7oʗ (Q30GBrYīB'q{OY* iQYVvx^z >;UPSfLy\zsfQNftzŪ|ϺwUT9Ur<P &:Ü :x ACMo)fgK{zAl{r @ /W).LPUfr(5GgDYiYnMf+y( %˂] XZ(\D#Ҧ7ܩ~M*(hC묗>b)p /idыS5+e4w*`hN0srs@|q q`%fgNFx?팗:6Ȝ jѩ+`OjYqcuP X>s:='P%3qopsfnIoJ^~Fkᔊ&L-RªTVW2p4*[({TaV D3HIC!9K j Ly<8W8O5e" ' Nhak Jsd(RӇq~Ajt!V]R*i?`\OҬ^`w}NٹzE=_B739'R;!vZ17YV>dl]*oauVGת< vU&%ir|+͍NOjÿ%%8ƻP mR%(J ׸cǜ)X35 ݬPijybhL>,x,(*x6X7V<)VϑGպotͼS!Je>q _*dyid&*T =ZyMj;k;Y&謙CtW~ӪK6c#b~7Bۛ{e&Вܢ,c;k~"3tW a4:/_vDiJ& \2G0&^L\f%8e懿etR`'ouN7;iyZv }m֏]yC:{~U?Uk_K^}9t*&s=jH,rix}@N` b"] E8չfMI/'0]{^b? ,mʂb8&XN݈jGӂ.C+bu=itcwVJ=~vWK#%N~[Q/NNgeet+Å+5ppNI䝁J)\oVfi&3h:aRb"$瀪Fjٿ)훙o3뷳8P`=]ܭ_m]q!O@PPR q}ڣ%R;!j1I{i㜰q?-ozW#ڱoս̦l5T]&*c8ECkICԻ +sr\E]e0UaFՉNxSbmBJD1tڮj {j .Us0jQ_T5;fsTIiVⳒm|Az-@1בaF$TȨYee~mj. @*3;S7sn9s/S_.6=[[=5\tScu7쁜4̪g%&Ym2%dE3b9j} JP}^EΛpX1%͹[Z>s~y!#~IG4N?T  wft7h!ypO)!S55k#47%_-qJpSh(2 3,Rv4C"rƧ>YYcgSFUM ^T/i3/Ч:`4=Fi{\Z+x¹?6vPbr$ݲ> ɤj58vaK{ܧ i9I DJ~`r@G9b.\pK-pZ=$5u/_TDmcvy?*.6+[((&@@{i"[oe#R16g3ږB̒H# :{ʏedfw.=b|!5{,kӿ]ЛmXj[Μ20+&%$=,;/~?:qIn:M]ف~вc{C\b=Trv<8n;CqQէNZ0͞/d`DL^_`{.2d&t~WD+':U96d{s,䦣֮PlKԡnC-\̪QS=LCmΡP>mAp8 YQnnħ:Y٫* ~EH{jmjWQ䑡XNOݒ&jB!9ueGFs(f m:Ռ؜?^W -;9\b3:l.PRQ%g4eS{Wk]3VY\Goo-/+D/5S_ 6{X%+cj\8{qCiMEwW:ndulqNjO.#l1uiFs8M:qh-[o /St«Dw4Ϸhj %[(צ4=Fi{ W1Q^vDRMlViLe#=kC)&lJL]N۸=sleMDN~`r@GU6-YEXsQX;X?S d>pP W^WЩKN_"r3f~ ;I갗!>M?KL%^I:څ$ =y@%j]ݑbSB'mwC}NrBqR5v|AyAvěCmW})G2g^FfHjMdQb+EKOJ֦%ק|;}uвh~uL8C~[pF~zuW'7;(űc{ wh{jOv|>8w:G:=1sGq\tm)&ɫ@Z<ǶDgsq$D\r^uTyTh-{}T]ƣgG=u:Alyտx;b3\jK]l3lۂsW TSͺ;L޼ *F+,~VY, OzS6e1 eQ53Q?c&juVxWm˞,Օ8y`+"h4n!B/{.C:c^ Iz%3 F{._tiVڳ(`ߚ"}En;V9M9Dh f S^Zɧs+3d-Bg긹\XQ =Â֔4 _NNKX"EJp;yѰ˘ cZFɈ {-:<րG0/bPtHۧJoZ: By?*aZ0.[lh6{q/h13/=`:٪Y@PO<`̪c Չ@1)GR(搣~όUA{J㱞\]~zNSR4K[Dw̝ew{?cvwcžrŞM87ŦϋM)Y7PܢL:/sSJ j9 (!b)f?n&koV _P$!D,X@V䛃JRXCX*J^# j#2>ƭ&نv=kv E9T{Vbd լ.pf* LŚ>*{v5*&ǺYҭ?hk4/.F;uد$9$v+I}yM9P0=*Efhiҝ\".6+B>BPMԯy,@ldJ߭1.DK6,P8`0MJY:Wdu j/>L/$խ I~R#`4/9؄E='?8'v۷/S@ R6zNYqZ!ih&kb{v,M*yD̵ º۷_) z9Oq {pͥ ? i/r V/ή 1DuΡ0;sڻ ~u'o{O/Ьsrp:J:CUMwЊcc!\qM!N1̦A\Pye6?FE@|)7&-kolEtwM#׃t>8gD t*1E]*lM Uz>cM&2 tEl{Q\6b AΧl[m`?9B[\34fQ=a%^-gcr͙ `[3Or7B/̍:\Bsơ̍%:0#07RnƶבF~>Kf?˝;U::Ǯwf[12vKydE[ Y?.3Vr=g*W,%?=R ߈V,|rq=^tmV3t)4Z"{܃ףʼn=[:vEs2Jb»x2:^t'd_ɏ =RLn4 RAZ#b/Ű zE̅ѡ(d1O@זd4u$qzIS Yf)ů,Qw(mꝃ\jP8@4= z1>55FqU]sm^:R'蚯5MvhV{TpNtŏ27edW3L%?t@HӺ^*CX>cl0͹>{w{Z9 H|HD@0zr OP+~~JKů|P&3Adb  doDxCwpʇ=LU]4`C]iՖvZ /F VƢ<959U@A܄3caQ[?˭f'@ٝ =C*ӯA[Ru u |!1B_#A-xRWb0E4iTW!ߖHٓ{{oQ`վZSM߭oxD4l6A'i @ܳrXl;Fr8&k׼r0Ճa:7ђL9).2ܳ W_m܏Jk ~"ڞz|V3}jU2aD )%SMa|z6VbFVp,KVI\^ZKXUۥ5qig pZK@燚Z|ř 0+]5@hfl!!> f׾Bխ@L )x!Rm H[q5 箼 .v3pB8Ȗ@Y:H#5|pv(mE6Y`ىLTgE"j*7c'z}7%q@IlEB>pl߯0Qۋpߛ5K鞾1k?׵7߂s>29sjH೎ tH%eYXKZ8 z,7d* R/0Qm͸^tlê j/!˱/95n=?*T:r!@?U1oٶ(G)2:a P^K-[Cj5ZSZw*,SA#dx,@pcDY%C:rC}_ʥO8o:)gLVh|Q8eg7]$OOS$ކf 'L<62:hFx~ $zGnh1 ~ۛb2,1pۿܣ0lR]?hF7#¾<h дLk6ߢ^CI?0,՞}7J#R0zU-]uzu_ Lo6W(Yi\\Ƿ,o9wIB@. "V=}|iS@䡯{㙂֣Ƣ%9kh\>_F޳vˈIAMYnŠ.f񧴁6&mH *u8oe8b5:Ð o$9@ȸ{榺LRRM[/Ֆ)<###H@KG͜j ev'crOMMW9rHG0EWض֨hVuw vѨa *k4^* |#Frb"\yT3Cj h NL}ǒQP#Q3'oHJS[Ƌl'~'iXec^EյYV\Vuz*j]Կ}d/dz=hhmI؉% .{ݱr2SpE%s: :GV4Xdv3coJ4Kد&2hV"sdz3O^WiӍ"0'/+ZMpWuq=׍<Vċf?^ 5?גua2ga6 `vj9{Q;QQ/QXi g߁+¥m7/jig [!8mbEwHI @g{9u│=vG`>XbMPa +{yY݂qs'zr z^!N aXY&"k-BLEZ N.cI)Ê /Yyrxۉ!wbj6~8C=C5Ht$rBַ{K#Dﺍ]b;om%j}qt&C/=UqaG'O erm!˟r/JzLOqi⮵{k}iH \T:X|:y7%X=NZ |Ş0ph;n{2+͝0zHX=^[aP:9oQ:ڇ_"b@Np4/l/ߢyڠŀlܮEcCmpՒB77vGaa\k moZP%Ίbwܦ֜կ)LAU{O(שǁ-]L:m\/2vAkJ lF]eN0'B&/ᄰ:7ڌ{F}Eh+Ak-==o_BҬ>uQN4ZwN(C)cbvY%yin@4u9L#+ЁMsɟ=Iq~&%' cu5=c(qԖYv㺽pݯtίMgٵ< sp'|V0S&:\z,757Kͧ?.':|iU.<fT_A]fqjVs,K shosp0L/&2?Vy|PzϨZFs'&;ۆ! .4\` FHpClP٩4`iv›뢜5C\S7.Đǂ\ xsa(@R6Q[w&>`jGղڡ⭭1AE[݇Ut( AChkνQ&1DG Yka4_t_F0L~Flhk=3AK[(:4='G` LHos>ĸcG|_:oȓLRԙ}D'Rl:"y>W| S u{_:?/72o3+H05ǭ-t<Ԕ"On;>1d|PS@USAMPE^=րZswG,m:=-sѡ #cϛc ѽqL hfa[7Ǹ. #~8DkC~_!úWT,}舵 :8Wu'V7=ZfĽF1>丄N1ȩu1:ꦗy_7ImT䆙v$[70F6@k7?\hSx3O3͸ _Ή(3eE{O=ڈw5eLBQj]MhYqф 謴A/#'23R'm_%Ir$9ޯR٘A}H*I]-[5y dotW5} [h![oP/链']٢~kN!DTkWhUIͶ9#ڞKz Mf| ܞ`הْ6 azĮ(S ԥoB2b O_hb-撞)ʙ֩qm{[e.l }L-E*@ז(f*dpv~Iq@WX̤L`|az\#(te&TT#^IoCAR01DB ~ZYcavPkLYcf SZky sk J0SGQ4 }a XJV3-)$^S0.qV_ XVB-(z Z ߜuVʣ1acg0Bw 8RÏbԱ'eq1ܕ|̲Li,O8rNs;ڛoAeA(bQU :2 &, ^+% {P*i5lWZ3^Tc*rz5(YTOpRvW3  .eB)ۍ 嶩$'$l@^XPd۾C|BLs{<]dؕR:~ Cӈe|ږ+)*2hH·MeG/?::{Tn(Je?t&(4Gqk[ >PZ[7OFe*O> x_3I+>H{뼅+KkBvΑK٫fn!rcbLb)֝ZkZGnR hdͲ`k\8Z"ܢ19lȧ~ҝ)ǙnE|WS_sYPn%_Q=& 82&Λe89ÜvGŨd; V75jm><Cu31m[.ItV6:HrL+37%`e¨Uu8LüD!sQG4]<+JaN)P+h^ sTo7QW\ֹͥeRpc(PTJgvrݢu1Εg0ƀ6JMwwT۴]2+@cr0@k(Z #Rˆ s, 5p۳k# tfzQYҰD*rl-Kg} Q @e ؇5U%k].PA ZuB9՝ KLoLYFit߫ѭ?o ;it}9[zmo:-,Kl{ZW=X/Ug\ify R(J>L ڈbZ2Fj7[}ThxMBF a㨮|)T҈ka,zC|C4+%~%SӇzw:.6tb=-;XYJ7^QI½ăȵTLjGڅrYű(yv++O˓xb렜E8/v+ kʵY*/]F,o6K뇛%e۽[ni|[LdG+kuwF ȃl sS+h0k^s FՃ 1%mS"b'2P&XuNdbBD2~AZ{`#^E/xұVDKw-P=~šNQX)jEǻ^Yk5śe,"6v+/mF-?y{q[F)P+%=r些24b¤_c]Qfl>s m5i8|+pX9><#YS%4lqvoo^Bm+@gl2PPq-hG')709Gyg> vӮ:)]#/G_3%ϴܮ@2k&lP^0hC Ʌk=m#otWd da},>P#ӷ1tS қ;5`xӥge3 ~CߧvȖLuF~ht6%}Y']uޱOoު o5mi[Yg)^sİխ1rLPtÆ,2Ȁ{e-K+r[v6Ѽ۬ղJMe)% y|\r\rX3+;3Q MU81|C8S?qu>;d,: 1C0wtg]AZ=e8W5;zt>jȢ8s38;[מ?Bn>6s{\OBHݭ$o /wmmY49dbʻ1ut[L2°vdAf͸6YZ~!wgd-efP胶x12rYE&(bsm,QXe.lTФ*-_ɒ4Eޭ~!~Vr,}/ #Nt@o$ k`iRTRTz5l޴Qʰͫyu<<q׊\a. -ӱB9p] 5&ĿdNtCDτyl4{tg?9fzmrm-<GmlOzǙ [vl{E7.˻Y}[~4=zdE>t]]Dx֯/75g`o.k30YF҄-o5/ߊ y-йcoi]ɓwf2_Q徭-yRREySiP!h*$'fdޗ Uf 4w\ ӋL1k$Mgo,hL2~Nþ#N.Cqh+1|/;o cL]`VgnG󇘖S3x^2Y kmOBX-{kqJ2ïd/$x~6--}6J4ӁthsG:VOZPXTn0%29eeRAH-$x1P$Fr=1PL\];i"+c75 `8: f)Z%:+}|nf9AARQd݅`j쎘sxLwƯmkmR bSA3p"g0XҎ]q[g+4Kv.2ei !_\Fo6'mz> ܰZ)3 FogP)5)jP +?O/Ku6eaX[5;ȋGipFrVs@Sg{%Np hMu7Ks1ʭuwRUxJ[ZY&eҭ{vWj3Xw# n]| *Lcs:D'h][ܵn45k ~debKΚit$d~k2b7:H5btRImgc`|n>7eIzr~@M)6- =lƾ47_` ad aO0wXH9ТG*G@j bBqXvg`J4|ʝF",r:*pyº`@<TTtODgq9zT>b6cGEs¡V=h)e^+ϭ^MhH8OrRv&1IIUsK:Y=|}7e>gxM; ˆ֖ y\v,BJ!Jd[+7z63ބ{wY)?kA%.ɲٕ59۟_d;"Y 6{:sߴǬko~vdzJbp_?^D~3G5pi;Ӎ,"juB  / ?6,T#t-l*Y\RUm%k$vAJ Zr.}oU;뺔7{% ,]s1",ⷡфտs⨒ۄꜨQ4% "ϒ-67Q5!f幎PU8i6!і|節F7fri_WIr$G+žGde٦֘$rBW.8dJeIJ(7Taҗ_34,/ ua| BZ22rHZz5U% >7!¨c#;WKg-}Ձnyj2)=\/M{{9?~3DY!޳vdiz܈󫈷Eyv@➷LU*=eD O$[QyfKjBcGn}"6%TWJ`|*Bfv rڀ[>OVQRS A(4y{)Ŵ ^ދm}Θ%篩b.qMB8}ӯ1>',Ev+ne NKDS0=|ZD}éoqbbwR:"z,3GU @|и3h*6;l-4a%z1_d!-4N7:-٘TcjXm?^W/n/[˓Uwe; YjhL<f _:X:c=Cajm=lʉsžeDkFɖλbq pZMh<_h#E;IGn!1X`L1v<޸߷z}9 K'iKij0;cXVPo' 'RqJ]MB˯3w)UzL[z5`&=DhT+(Gl`yPukyՖ˙xr/V+sqzuxΕjfHEtS('g)iUfElܜMa׼rjC9b5WK8Yű[Ȼ2Yj,NeGȞdK7DHZ|kJ]sOӽUu|FnVcU`vu^K:-m+[? `/iF9wPumYzh)|.VV/YJ?I%o%t;M0Y|OUn衧Q.q uuW4L`" >'[yO#+BW}9al".Q6Gsf^R8IZX,d((d.~/q}q=刣>stoJ.F\ǷbQDcbHHRՄ%(4)]n!TʤS`1rV>#ώajVS#*#䈪jTs亥mKzXsA|w\N fŧ:Щ6tK뇦NۧNB9˔L0i9uk8>`L5Ip=B`2X+(N'hkA`̔g DzkYZZ<̯j[m;;Lba{6y |3u6g}o ?_X} 9 F -Il \$+XD bB4L-Eu@;9dyN |ՠ#&=UIXD-$,2\{w{⒲5MWg[u|^vFİ*jm'@OanRcyݩ1cCl, -'-\F|j,>[{|Qki1H#'u9˜ =D: b;oo(9of(+.^Z5@c7- t J:\i:^t=YZ_WtUQi1&جX.w:`\YS6GVQ&K\٧Hl>n5[f huro,q7131Z9NM~^ՎEkãڊ{/R=/OY?j=H0-Ԣ_ԾϻPചu*ɑ8wb>Pؗ FСyr3sj#@1TXG拹^-zd/uIaMnl%Doޖ]A+!_cvo]BKo6rN,B)Bμυ9J%ovsd'^eCxӖ 󡾤Z"^mMEw{#lzFdwcWo ;o/F%m3c%`eªUqxQGY9>ss=n$|:W0pŞk/K!)%-Ui4g>܇ qh'zܶMNsޣOavtwŹ 6>BK{PtTC fVnTMΞm'S*B ?/ڣ,\-%U43+xdkQy{| nuCqLԌd-E_ YATےrD[kya(lJ;ӄZy.wD׎zBz\|]o+M9 -~aeŇaAxզUIh IÁx͘@%f 'Rs Qt!5%D.fx袒ߘ+LMXAzR0O܁8Hsєp*iK@MkR%"uҒʪxE$TϬbVn J̪0`~α!eX߅fR 6!~kyfſh)[֒5216ʎEfYX)R) "=%yC:*<dόFVnk~Eo}/Ɛ/΢*όe}lEfUwC;nuWV:M8^V$VSM_Sn8ρi!Ta~=7b7yp0N /YHsTZߑRҒHz03jm,rK2Lihv{Jΐ "yh 5XePz꼽lY[v^EQTY.5>Rj2 b(쮂 gwPWq!@9"LgR1Ÿ#̇f Ut qhuYZ)Oa^8Ҳ*ӫ‡>V]|SՓQ{t*~@,{9!`-/R0Ϊ/8ֺ@2=GOdQ:[L..XTjقS|U dvED#)W^:`|EXWXa~\ ;="wbmAa=͏ 2+1<f'^&@QC)*cf?,-g$\_"cl":Ys5m[}p?دȑxW)}yOTaɔT5mS2^"pS+yz|3n 82Cw[/#ӜI&ET,4fTݹ'1=O,lYIr~VϥL:-ǁɱQXݾ:K!T_DZTEٟ*.b.txɾFg"Qo~%@,]zʡNN](4a-d.p+Ju%́ 2jM]<%XCY%1j(5'%CK[̬H6! W-\91HFϠm 0U[]cm.q[_OqVCjV=-0Jm\КNAIT:nkv,oRxTiY(F*pqVUn}UL{LkonB%#gcGROjKwz ]@D,"Od7nQɋ,64*[` ͉8ǎe|8u^C@܄>yvwuė_/6[GQhƞ.㻌br—"NŵlJvtV-Y鷏uCu'b;޲lb&Ž>)Ca<A *N^<"jlTvR߈$*٦erQk N+B\w_]!tGTY0 -*AS@2+>ux#k=S-91v#obcvZi,*?C7 ev]ҜS.֌Kk7$ɚD1 T խfs8dFŞY;qv!l)mA*TIɠHXsu͢՝t0dPЭa9qVRh[eS>^NtBP/7P۪%O6:6moEbbOcmtjY^ ^ڱS22Nggii>={PD-TG |NA+#XPZxQ.-Ǻ,-Շho0~j󻾶?&▯ogUnyRTؖdP !1kV\Zic{=\qĹxm@Lp"JHZKʤ^c[-kZZGH'*d-LU1}ǩo5rATieខ$Ɓ>*Y@aXÌ"/\qNH\!ba!@[ nN_S]}{'L踶_kԵ^Z%.|^5,v3\-x4L<+bS˵!5U{D/:SG66' MX CՐ[=7ѼRƭ5’NWkEAadY$jpwTܸu\4e>ֹBf!UYF^NjU]6)^6C'F q*m(TIK"`Ҩ3oԕy(}X){D%W(ncrmT#8e.Hʓ$ɮ-I?iGT9dgBY/f [3=nn`ѵw mXL󏆀kȖU-[v# - U LҪdXAXPG|Ne3B;!°w`%GBjt7c/;{ SP{ Yҹλ[iq_)q/w?WKr\9 /.?IeCT<$h's[ `vL6Ү%Vp{Jr\qf+kQlQ2ܼU-Ϣh 3>hϥy pca *|h3_K0S#ə$-U3q@֖).&Zb3:M}}BWgY]`A$H &)EwpvG<%IDQkV(g51rT;S 6!BLe0O U@Pʖ^)FRž zdkНp녛~PlR,e:im<@uֆ@/[I,6f<%Ɠ˷Nhۈ}z]srЊkٱ~Uɱ]tPl"|`3uR@՛\wN!1-t"/("7,][]9qȷdrK4su0r!\d'=<, }?g l_gWVY}C}EE\_#YH'X^Y܍.; r72ff-7~3U8p*WY- lOklǵV!> _P6!ۀKV!9v֞H{= r7QjT5TNEd9UotƭA?AKߙ0+\_Nu!qj^ d%?qeU?p ҁ nB4BȢ6g"/mcII"Argд +Ym\a_<'$%e0OI׫=RLL3~dz[Ԫ endstream endobj 168 0 obj << /Filter [/FlateDecode] /Length 64194 >> stream HWn,W}9}0$9dU3`P3d2Ɍ%{q1pG>b(`᯷v S92@p%{_לVJt7μ߸ ᴤSŢcβ@>h8a9R)#{)59x'ׄ 5kH%LG(Z]Ч@y d]pQ.Ԥ5FpA~.>jb&O:K q=π񨃫FMZe(Xׄd|)H)$d` }>#^B%c qb7_jnPf%tvg:XiN*|~>r3/p{s{}%ܟǴ^Q+,t4j E965WS;KtZ>Gxb)KnjwΪ:o”DʭjSB_4O B 7v@:]aIa$yxbGRgQ;CAcȃGBr溈ݣM*N?IAl0ir!?ī.~ I'q܁pW+!Ɔy=Ů1 i ``]V !rcHik6#`Ȉ6s}n,{Kp}/HO[ـQֱv&16;6N1=LcH^Ғ#v[3缭YwLxs @O ә>P&b6"9Lp<)ZfjIV(7l4Sv_Ƨh\Cz8lbGahK,髎?w.3{Z?db/?_Ta 3ԒsDLj tnHeWʌ k*y tH./Qc|fEkVtx$f /(ܷ'YZ=)*Bg7Dx2`TC43v| ̓w@XA7#*,<䂠E\_ '2EcRQ09 ۍeѹVlIIyLYwC!".خȎԻY1Y[TJ'&xժ[AK/ؤD@fa5MeVvfz fq}f`be%1"|=Ļ#RO:~ *~vM u/9b+V[m>fVYVK*&[[UX, O!+|0*n$pXiA=7t.ws@Z'Nc xB|–:ut&Ҽ`X ; t9/Ïܸᾥ,q@T&6B*h9[3)cf;^챉0)Ux*?̼u]fݘ,Qo>aӬJV_v3sm">eo6~K Nkfc*jbeYHXVOPg nc-T!e&5~%MVYQxmq axUMLlXXCT0Z `"[3q|!3 J̛cj)iecuFgf""1+SIܱZi1[pK UILAХZ 1Uk0;5浝Ici g2O6ԑ;L>NFNKb-c ֚Q([@䩅YeW:@Vm8YJ,!s8bnfQ@OǴ CKBjqA^x⦏V~aK>Űc"L 9򜦐V:B2Q!lgqYo;/v crR,=W'|BevO]ote؀ЮZ\ EF肭paKS@AY7ڣW-㛪a.yY/Xq}/3L]Ѫ&EAſUVMxt`C[3Yf(./SZ=,$K ikıҐ?r+q&[+RvZJ}hsps+/~= IPG p΅=kA" @L⹐k| TH؜mfB~Gv`-^]~Ky핫) bhg<0$DJ")@\J9:Gg>n?%q-h* h[XGeɨ'lڥtD瀍 ddi ;HNǬ"WQf1ט2%hMRMq9υTWD2! ygI!nBvGӹld˾Ya n1Az{E DF'M G 0J}޾rӷo54KSG4ɐN-*-2g<`dz'sBtc|:~+CroVY} (˱AE#SӢh.=/4̮:$/yBDα44F FOf,# pxeLj' Ö V=P7M{iɼW|)^\Ո@ލ>Q|%{ +96Srl6<݀n]^g3~eE龖vJ/Qn%@Fn+?A1CzEʫ:6 QҔ A8J[2X=(>3vϏB_Ն΋osgf6Agg]R7ѷ;D ؋;r]m0k Áh~@uh@6`frImt.uoJ@ ۞ӁmCBfε*t2cXx<|n{YƟ/QƯm_?!'rCTJy-T^l d2ějj&R6ܝKu9=dN̗Sx?OQ<3Ӟ('r_RNTN5O|(S2[2ߦVFSeԿT?fUoܪ7n'ng*'ɭzV=U'ܪ+\D;lOv d%ы\d!3;~X]^ .(ԙ\dc=P my 0iFGdimQ7vo@P;PjgրXWEK.K:{** 䮀/<Ղ q;4}aT~(X3g'd$Av?l~sc|6II Xʭ/p8\ٮ}H˗}8nouj'0jmehI'C/3dBj+aab,5&Z 98U2.Z?`:J+9OցXg8۶}}X|\oP7H;`k^O_* ed)sAaG |gE"VGL6ZN];in1Nk1ytR0rYϢJ9)| dz#3XOf8Ro zj{VT*13$3fZ06 --Xl]du|!cWFD8"+B)Cxb@/-{zSOgeg?s99N_O>~?eR |U1nDXd=p(kdSǺ\w=J-C]6~ wa۽LW#-iAS4/hk=*<:IEFA VBjyoF[xѥ QFMIMF!nIP?judM8 Yiu 3G^mYLK5l7iW6"'UD'xw4~5dbc59߸&toBpa==)c璽A峟FtKMVA8pLmsP؅Wȱ021@i]C_Ce+(/ʾ0uiIhV Nodk*lރ"WpoVּ/H#\ϛRK8Km0y^ r9b9\s;KMt#w+.g|BO6]amo%u ]`#tB#ѷw&@XOzvLhz$2+5R,2a;+@vLYg/7R WNKUY ?fT۝~S)Rݩs*ܝJcJC(?Щ+N%ݩT٩w9;eMܩȻN%t*M* uTnTG`F'ioFme }GVc9jj$26źQp:t{u7g$_).FB8Tzu22VUD8wZҜ`%7L|9\Mx96FrY>lmV`N8 .lko;^_N.W]NK]λBC Ck|JO=yW䞂ؤ( ǜ̹4̩ygNsbԙ{!†>,@#iu> +uR+$k% T i'\];wK=ga3Dz׽w}}w_U(^lMcO2q_.S6$<.'^u7yym{UWN`TePoD:h3;B0kp3Ai[ VSb7=v64U +TwW>~Pd7h#8KƸuqFe4ڮ] ?yA:lA_kψ(FJAxC).rjr(%Ǐv{sw!.ґhhvwRsӔJtp!q쏐EƬYxlD{^bC⃈JvmZ[GۧZD*'E)̌}\SlAw_kd0IS8I9ȶ]SVrT ZR p}Mc2 i9/NuBf0Ѫ̘ld3'D]lXCtߘwd&f_qL[c.NͲ%Z+$< \̹zd.JQnΧ*ۉȰRF<4\cTvG@Ս<J2 I2{MЏT/MnMU;IwEw.mʇܒ]n܊[t[{ IXޠ'QH+&=($^cDDn1Hi"o'9H B L c @!"Z]h@""8]4B0OC,^f};]&1:Y (&xw( =M4 9eA @s E8f+A, l8nA'l=0(C@rDžCqrOnkDsd6HFG! !!)uh~ mDʙs͵PC.XRߡvPs!;xPlͬqCx.(ef`1-W.#x2ӹ$>-MּYZ>qBfd7ISf:ٗ\؞'c ?rM񙍤f!}N$5~@Xu]&T2cis_ ڦ 0Jcpت;$qN[]%A}2/7>~YM6PQa3ڪꦄEAjIcMVk:C-j%c钭;sS$Fbk*`.|kVFR<"QI vaZM aE> a v`iA I5_h uyiVj|Q8v2g+SHcR h<>%u:ݼKXd5? CO \ZR*-5A2\:|I!ݳMDm4wF8h_dfftn p_5ی7pLĤƔǚy`U fuWQהfn~la(3uI2$3W5ZWF^=;R8\{-}1W "?t[ n8lEsCd?)B?$%<4ˎx9 "*^hB ơCRXj ./&Jf Bk=GrțkS'j4Ol`M 1l.Ԙ3Opn0%gSı}:Cy-ve^B5Zc UE^$R]"Ka&]~+2EB [֪Wl{iv{.*1UʻN~}؛;(&`hj{ᚄym>N.LZ@ 9nd5BC»H=MȔ~gtq_4Qű5;83Lw|eγ2Vmۇ#psď|X·NF:);8zF.E6{W)ĄJ7Sfou ]n,~z;8uIGjBjLV/jj lõD쨕,$UhE,ȳg6ԅre*ٴqםԽWz&:Gtlw7Vd$oeIӲ$!.zlZ|ihݛ\v=lP\˅l70ߙܱp5RdzQG]xퟫ쵝 llW~SArr670/GJW_{W&*0gr 001}47dLeAQNޙM*=uϯ`qtZ!;/60f¡2־CeWg DžRS_WH&LEv}O>b1doP^_!_ |r'8 U:nsmk?[a!Fi7Ƕ Q=MO_ R*3h .vU5$uh*bv2H-rԀ gڎzPJR ct/Z 6 ֐@y 3wl)@>}bGE0krpp&|@p8tyYօ_ǯaw/tzay,זEҵ?ݯRǷ5zQHo{@\|m:hfonQs[UA~ȭG\h:>|njsN$=m)G1EK:U.=+.;u=G % Olzou ħuMJMD{| edm;g6xj-JxHC~v[ PEeT';/`ݚq 5'P˚,܃o6aSc.@w5:{O8KC t/h<|.GwL@RgbxP.n\n:#:gA^Z5*c" b pwVcjC^yo<#,?Ax-'(4UYtsEMw: FO/7Ao#r\d_~{_۟/I{ؐlt?_j{t00 MǤ_/۟E+-:%Rb-tyE-{Ua G16H|CSoZ ba 'FHG麗rҾgճ*G:nMDFꐞ?c?[t$&;0ݛe64(:wBP.qP/=A= s`n MA>`j(n5*6P#ݡJ侖nWpsYM qla3jٵ6{})d@'hcdOWUs#]ytJ&l,Z$!gֽL7JO&wB/T9>YF9WZ >̼<9!x-1h2ld%孋z"+]h'djkRo$X@W‚ȣeP.uGx0ga2 1Öy 3|+ef@C<74B&ƌe<0.VPfiTb5ڑ/owt *s#XURn}xԒ8~dJwyf( }S2>T1LS  6 'pk ON Dž ;8Q\sG̩$*U7d&m 1pYyx5j44Ði(h6 ˒Q.5&@0+UpPDyRIy()n:4KovHQ; RIo@f6R({T|Azi&OMV ⰾU>_Ƀ46:2XVɡI 8,e\[V_6h 2"/KrEBnL.\{+H:̇[zH6rɳ7 \Ikgmq |q4zb&b{oĔ-IJ۔OX|& Cy=#J½:/ؗvuxS?r yE}$} A_Ë\YqI:=Ta5WbU뫊Gg0Nah>'H^GmzOLVqi U+.kdgG\$"X^l4YΘ;e"p̻9Q"-&+;AR L=PIF1q}d10o1/:+ )$" fWj|rrkUzA x₪lNߘNuv*; ckԑu9ىk;;ԍ  1뽶m榆z|knT{(0=ȔÕ7lHIL Ee~{ěJ jzJƌGuIaKz(ſ^V7Gɪ̙(\50uHu'/TޭYt oKbe\,3,u$g*WVҁ-EPXpls_y;i)Uۺ< Tlm=J2e=]cf{y.;}ᛠkL8=ab=#8IJ"+H-Ro#?gK]j~n9Ö9=6K4g!X%46k崫mÿr(~XiH&U?%O@P=z+bV@ktyۊƦ&@h_ldm()S|(Y iqt4+?_3Պ ɹվA5]>-EogNRDcn /O1 Kf;KMnty-(#&M$vh;)/eHVJ雂;hj+1U|wA+e es{sl*)m /`I4i12Ueq)ID*/ 7?}TUCS͟=;!U@~}H%@4>A)sd}<qMmPgg>҈؏^XzԀ=@Ƌ:gMSCc>[!HoR5do,YCˍl ~]^L[dl$‚r㈓l&/Ucyƨ䜧dLٜ**F_* &T84NU/ !QonE+zCX%tHg!x㐬EflcO'nTto[|j<R<{`2Ә4 u a[ƒ<ci3R7ݳ/vj8XJEtŔ(oJi<#5EBhq iɧ:(LA+zkZy#ڇ ܴc>6*2HߧVMJK;V2¡%j[0CAXGjݡ,rB^d["bw?wiE]'Jʀc-?+SmYSvHKcK7ƮKk\+e4\ՙW2QH?(C*n;Il~8T'u~?Ȟ Ufӧ 9XN(ӔLԷ(QAuKRYi TfB% $iWʃmg&r?:<:ڋ`LSγp)ƁaA|\;<gGdF*ok P,3Y2AEqĉ.IrgnRH)t0sdС`ice'> T"~YI 4L޺hai;3'Ygi;ai'y̸/oFj=XZ!k!lP{չIWz\Y>2K:X5ܷ~R_:s%tn-ܧ(S[e&#[}֦۠ :VUby}Z}vM_gQJjc__SdsO!801F$,׉F47Z[!ʺR͝O76KuP"c[QJBHӼ(zSL- _7(O$ (\g u!U5*V U% SjEK!:%mq8?xb5~ݬwQ*DcJG=X45('YMF#_^7Gce ľy5N=ńv0xKkG}4 *ɳo&^}6i_5oz[>xGSH3__O|]tnL |w+OU]uF:֊ʔBq_j֌uGoeѤ=Xک^򷥎u20j"S[4G*֕:p!fYR*ή49(lڹ` M?5-a?c=6PDL`j{a$N]Gn,&3P}$\ĶR9 oSa]P :Qߢ.Ս}_[|W/=>piUx^0Vo2'28,5duopl*Qp! ä A4'{06RM 8Y3zSQvw:ziċ`ؼ,(n7ks+o){eCftȗ%nxR kk.jƿݯF=Ty~9뛩O&kdan'{7S<EZq[KQRMo[Z}89J0N*ԚÉ'Gp3e #@MTh䢖fiS?κѦDNSqL"[ڇ:%X,ԉ)4$n2V>,zױLs Sh6 qty4Ԣs`pk**h),ḯR"#5bq39-V "{e*\Aa))_Q.^\)'*5/06?FvZ렲__==c +k_aݷQx)Xkt _Zԫ~m_;F8`ӤԦx"ֶIsgS4LB]8ri겕iy\s?,墶+TErwB?8Nflv-(LAt7Heű7\g5_E#l|G EQ%}ۛ?ɝ#:48gD$-ÌИ'QJQZ^`\{ӸHެcmW=q0wXuYw`&tGsi+%Doݦm?GC&9}}ۋuٺVfp#4Z1h9YDr:ssoֹɝgT֧(p7겍;Bc}5ny-zNErqj|9ͷKmKԆL.co@dSw}]8N%V6I;b˔;մeo\W ܨpύ(` YzcC6uԋpA=v]UwWqjNSk۶҅!SZmHv+.xӮ>#Rߡ1@YWSDWLnMnћ%}pK*+)2tޚ!ٻNypR4bi5b%J%YvS3BI&zxVF|dF{S&!Yw Hq'ٛ ڰN`8l*`WH;a Jnu1'J^m T6SܽSʠ`ȶ SR57y$-yɟ YKˢ*q4(*%iumS=@23! t0Ec-/Z7pBTQj3eI0`m^楆M,RI4ǾŒui.ֽQOC'o'Uϊr0Es 1ƨ-6jcKFjSc)i/̴eoƈ vnUlԥ1K ד)?ФlGڗ4?A6.x&d-"wzOQc>)y04^P&& ITY^ReV0 S£kD"oz2}׹ Ϫ/ݭ|2ڼw֝ռ|a#MfZJp=YEݵbPhae_}h 3S=F#4cA+Co]fO!J!19y =XkLL1Y)h>\ sp~[_Ч1?Jx;onkL*Zaos7h^,'?~zU{&7?w$IcudhxF_>hlyEO{Ϋp횼f$Ww>Hf8,Z~bR6K[+n*_͠~__?~x]1Z[[S1j1ZFcc~qb`hT8ƭ(1hͺb`ƙl ]W&]S 5mQaАv-nҖޞjaB:"c^CDDJ,5U+T}/%Yb/J'{RLƂʌ uGLn's'ہ!Ml 4T~_y ۅ4XRf'>Y$[Ⱦj>_.C,Uv*kxB5fefo5xVrOg]C"/c[D|:%=2m2+RN k3r^-96pߧ Tg問0E`̧WFD` 'c%qe'M 8 Wxgk >k{piZKmKB2v1?ib{,̛RDU]T3NZFU4RuMaP*ۚz]Q0yn/An`pM].Y1qOssKy-_WUH+egO`EEj%/*h@g[NCeM DPF>h NpZVq6SYG<{K5ZX}fO=]P*Prp!XÕor ?]l @5ɶj 29pEO$㵧4ꄷ:˽2!&Ր`RY;#K+ЇK ;ɳ0׭0D¸p\1PDQݱ"u8LDd Q1MƵh{f?D;PڼM/(n/>IP')ݺL,[4kqd]Ƃ b;E %HpXPdp,Vܔi65\ FKD?$# .[2;oX}2ju!aj6=LeBh>H%ܵd[L>29"Q̽g)qv_bɴdƊz6TIUEG*/U)s{7}SI~pwZ5i0 BI펵FjicP ߱LVPS֐ *mj*,>F}f=ޱ [=SE!1T6-WɓBd[W|[n"9d/ 1qGO糧&euA+"9S2^蹈XSVMiRDlʶf9Fe[`AD>²M۶K#d*iz3yc\Ó/ⱜ^jIĴCd!BXLh ŢoD?z1R:Nc֧ 6D[:M~xX9y3ʈΞ z0q.Db-e ,}B[_p[@AFdyd\:'g߮h\1"Ki}@ uAȋ"@97_,kQ4jAOM;R}z:6$F~rhtQ h~},X3):tr D%M3oAؚb5lنMHOӖiy<F$txJ郂+ԟHmWV+)5>F)qdI9_KU+ H4+*!D >3 7vA|^œC* wjXoYb-M$0-m,& wtlpĶm1ձ_sͧЕp7iR!Xӌq{\}-@i)yա;ʦ+7.J#Fў `Vk#-r'rJ(RP٦mo^ 殜'U!}貋m6,WW/az jdGxE`=ޱd:,ZDml,ۖ뱺ډ\꟧KrzֱRA_r*˱]:~=NbZ P̲mh,ŝD4l4kؑ_ڪvQnU[*7 ^nzoLYva ʲ.ă(QoxXZ$ yD+snj9 5h?asi}YK,Ir!g>efkI4ddj҇V;@s ?kA9M >7#\ɶm^L5<e k-՚9q{DtI 㯀Ӡ34O^0>J˷3LǖOlZ闖 3HFz•ٲmn>#[rٶ>I@A0;ɩ+~aP^ů|>hK[T%a,$ۆKe)}6݋xbam z2BA6F;V \x)zLwX +7^ 􆴬Zbo!^xYJV!A,&*Uo:]SaE׈J*Ȕзʫ.-ׁӱ cΒ^)@0'%]ŵcX d"^3ACr`%bj5<ȯ `R .$Y@z:;c"Mu:E.8%ӬJ}]fb_LF E{7]'mͦVnU͸iWĠc"8AbWڋl]oDbfvTCȃR:TjUE>U$ UrlU9̞X5=lo̬%*ywDNEhܠ'w\ȀFч90MȻ5O^8`D{wM<@R֌G_qiִQ[϶WAZ5t/L8\?lz˗{AkU6 &Re\1c]={LX5D{pXk]& 4x /Mc%~ƞ%>~ թ J[Px(TQ[ K['0 FhҞ1I9j<0ycRH SM=gӘ5(wCZN֢^Cu*HXֻBQ,<1}]c=ȎDuoDӶ8VW<y|ԕMŨʴ9W3ghOE9YoR96h,WO7KuÉ-<,fL_MJBH|@ku']cW]nA$BĊuU4׫80mƧ^Ed7Ezt姉!T ųP*rx)wo|`YVd16ube{ TWB=Q s})%p˽Yfkӧ (5xzAOlБP",B:1yw5c=I'w{:0M1מ Qe?؃"E=$O(NA' pkƍ#"[5p|ij xa,gʬ-"@p7Wel+21 MlU!ZXEd,vpҘvٮ\Bjm r`u3FvV@[vIjh$zmgq/|AR(= okNRW7!.B ʾFguIɾJdcR=`O֡@Yޭd_J$ TU ǰl<g|`{7遴%qҶic {>X6!\E;Tmoڦ95: iHÅS4>=ljK+?Os(ZܤsX۱! ^A"XB4=0mA{uش~+zuUȖjuLh"D{vEo?<=Įn.Z=$=0ݪ6>Lh k%7M4hCOyؑ{E@/WosE]=nb'2u"Aa26q3/N^P,t!lrKZj%# 4Uxrm/<4%e,y7f*}MTH~ %jߖE] p$]XyJu[]p):xT`sK̡?5$K1ԞJLIoו@̃},]sꢦf\m8;l Pxhn{gۅ$Rv7̭K.^{qVg]'G㛶<+O[4e[h4o,^Cѹ,0uD ϵa+7j⹘ ̻q/8K0D~fbN"Q4M3{^d(U5[^uƼaqRHG"T꺔qmU.Ziu{AtuMhvVM M͘},Sc 75vrWcx25v~ae80Z_jW~ܒw|b-t#>^^Mvc70PO &@V4 #1G[m0!ii7 'B,HP3=D4*/+` WHԸwre?]]njBT45pgHYpy8L,]lYDtK3D}9ohJ 2*IU'u賊rsgn/d6) f W6 e!=FñubSQuNqN缗P!('/}ds7~8S-m2t߰H.sO;{ǹ$ Eܵ>Fl+9qcSaվϺԫl֊>\-y\#y?qh˧_>__>؃%#poA,xY.il\WɒTZd1^4'KDk,uΒOVhC],a[BlZS VC iכTT K|TdYXxl3 ioc&f˾ܛ x{JQLl 8!%Lhqf]3Rx3R +IUJZwZu6,"YQʭK.Q r0fw#Baצ,64=gO@x>j&ѭf5ģҳԠ>6AZO0J]I0D1tQ` 91Oiu6K§M wA iQ Yn67LB5Tʆ~+q$fL F9{zkH,`p1&0nCaMy[]%[V9G2-V+ JyKNbL+pd4各uち&juOӆ${7l{OlZ1(͜$0krtTYY|"*b9\ĉA=d";,uXzAv)UH+[$Ap Khg` fosq*ojvϵZIA^Ԛ̆Z?wiwNj(YVCy£*=]ӱv=Cre;.ɩj\ۉ&E :.8% E:i~GD)-G!ش4e&7 ǚ0x5oX{m"Fqu|9ҏ>s^ @h=h'5K'LVH*}Јߜ.G<2?s!}9,^nEp+j@"Mݠ_= ABZcCaTߛ؍IOeqc/^%^;S⅕j==?B2Xtq`I&xRᴦW04X`%vcɖZ2aГ."ycw7fCb( ٘'DH5UT٭jܣZA>;47 'V %=u3I&^aͺ8e=0ZZB_s x`Ɋթkf> ޷) 5?ˁUi?/(f;LJd&EP:e/{`D'l EFj5vz[a\EMFi,Y%V\ғh6B5ݢv! E"4(DV4=ǑavC}hLF=v3֨ʑ{o1SCl6v>{ҸӶ v }l@(zg#|bKސHT * SLV=#$ax V6Ah]{c\ rW[E7Dғ u5Qag) ǁi9VhT܍?%L ,/1B8;MV<0S6ي8y%4XX#L5ӑA1="fDH5WN\Juhl۫D.򽷺g݅}NN Tlh׈];1b>@.ݡ3l%MVV6JϨ"sOqUZ-`4oCu`__unI7eVJfH`kUrX$Tu*ԟ"(%K⼖NǃB  9́ظ8GH,K[]#(~2'ԁȗ0 9<ɶo(Ѐ74 u`ɪL37Fo_75Jɏ`uO,1У"Z螑^?ؤ]ztFw=0y⺂:p]`z_92xTWtdRty`NA[mJ\ANVL ?u\А EoTc$BH;}p1IL܏a2H ux8PnlW9 1:$zCIVC[}XMr4 >a-vͫxXYʨ$0+*Uⶦ|VBpIŬq|Z_ 8XAʂ^>joKDvM-}j(aKnF k+cl$:]#)'2X9k80aK6V4ejS4Z@, n Bif1veo8ľeo, $DJԴe{ǩ U };=06OYv@HU٘g=Ҕs}EeCm>0P;2~'hM&(zb`] *d9=ZwKꞾgn>SmvUZ%*a(Giy@IN[f((z{L6V˨3ngɨcRIxۥ)Ϋd23<f<-S}覼3!/67?yz8;]Y2"yc&JUJ{=yAlLV)w`}=,F~״24VӏʐΚړC$#o`cn`0_mZɻɁɹ19 tp,lq/ ш]T}T'U"'YB<jҀd~d;VFڠ%?+|k/>:6NgZd`rG_}bϯ|_~zo;;,V{AX_+Jv:PZ8HzOaErsbFڑ=oM"g @c@EXUhr3G?C_,:3VVT'[Ꚑheo^w ?|׿o; {Jh*?nfUx? > S2h~AOD,іA~8/u\ L7_ qaeolIB#J{%eծ#liH:AȠ3!&1GժZ1*_AQ|3J! eBIN c]05Be?R|&-1U4'mq+0Cᱰ).}ǂ1 ;HW|T QLqr #>sKթRvs B)d;՝q60fS|AS ;ȝ3Uuطvx~ܳ|mJf+ ʠHw t( I |/ }ٙ6us!zq>.6|8ķq3u,˩;.sȋJZ3OFP+yD3ZcU& }`0Zt vbws T@:ِY!// V2r0q)n-ڎ eS֥R}:MFH[PmSE 3ba¾rsYѬ=4Uh͌ 5n~B'IE%!3DE9W)*4D6eagV,E!`}30e7,Z!iVTFWW'C;k쁜j]PGl5q%v#H+&v&#iܷMZJaێ抈ʃWܼ<Pw^fDj M)JӾ!%10 #8Dbp骠dʹrctmuO+{^nmyVPoLSZ@a$hbtLs=,$ AJrAbMsR`6.Ipzp ;9R){0dg,X ZjikR=2M/-^ΕϨTBك!8!a}1Qx#XeM6irI, 95u԰Uc&L:PS3 ^֢٧,P5dx_Lr댍_[?"I6GgT))= KuD(fMr3y2NW$V*#d7Svd2>1JUoS_MfVǻ6eűm_0?g҇rtK29{KS"Y/l 'Sl(#3@m_q nNsbwՌ5 _<~{/+RMibn [ʽj k**+?|?2}M903<=}OI>ݷ?/~x\_oyOwٚm͖͍V?rU؝_E?' !̺`K=1I!;); @ZcQ^LYu (?GTW{^Պ?0V4!}hgZz'sw<"6-:[ȚY|xq xGF3,'9Q> TMV0›fb'7i0P@pZa٩"nlN|zW| 5/`ML/ (XSnlIK5gl3d.s Iȋ![ߚ<5 QQ"4hgMfgȶE!{1d 8N7i2dnUi֫fO L_!3<#֐7vQpؠޝ_9&M7bFbqsF~ZÈg)C6 >uw29 do39*F6Ij=kYq1Qo97gD<ևrHvZ-GxŽpH΍AXo[ ?|̭(r^GWJgH5,#^t :/!{0X!#GV0'ӁmX^; cDYؚ U!OR&)[{dSe|QA)o5XݧYAz+뽺0"=oa΃g.5?%@mX\}ސo¸HT;yAf%JKaTC` iBzVT9Mێ"aÊ[U9f`1*6fBэ4q784mBуܝN~j…KyRC1T3aRn0+QusRYwėf{05.0^-98pS TA=10"]KJ)`V㵋靏}Lܚ10GLkc1lf{z3_rߖѳFSOo)m;z"m }o+u}ZQ]hXo]@h;xd[wR^4-ى~7~{Wg_gcjaR=l-iS*H`툤-0h -[)%fkd+~Hg<`<4y]_{NQXwr?!SM񬊉>J~V82UVkVe /+ @aN6_8& 1Ǧn6r]"-eȑ!cbSl fV&fzSѲss,5 DIb^=R ^S)\$Yl6Ve8Bx}j(>TOt˺TGv;^V~=<4#E 11j=թ(qh]0n=)SX~RXLiڶfkɒBJw.Maak|F mj%s BX ?fUI^7:b^k3$M2Pט@1"Xc-IOdHԯ%EU6}!w :gt;uZvi4c ϔ[u!vwҼurL}P ic5ֶ: .YS1U>,X]@h l3 q_‘@zz5nJ:3ŖdmxYf vD{ : E+Ċ;v ԁ?Z:^㸪M'1̝&[HB'[bWUPeqncZ^M ~WsûFVR)JKbx]e6qKq+ҡ= BY.GL/!-,fA<:'~AX.W[Fӫ<3a5.ĜS۽ ORUwyMN%Ci:C0ªKRi?fVM`M%#zkK!\X72V TEۤE=(H4bzWU5 ; ]q$R\ӯ+bƆ9LqzLa,a ȮCky|:y/w:ndab-w Cn@! !3dv@W ϋ~bλï龍y@BC9d&; jP+ԣ-TDj9ڔ#wl4өH[/iDž#8C=e5ߠѵ:'c9qyy`kgɱ+)%Leݵ(GfziT{zq[JbHn!grg Fw7ي:@WI`2 m!\pVP·QGFx=nT_N4!TLSQ9H7#Gob]T:#r!l'ѩ1*9rX$̺no;Q ;ᑔYNDVΣ"C3^I}Vy0΢~t9uz5򾦊xP2))-x')'kLJg5eUR`-N)T*>-G&6XTqF T\'U7h = sn 6SWy)v*(6-[ܭ%:L 'b X|ž^%m}r 0=`=p&)3f8ZCyCtn@&6HZHWgA^>hP[P+t]9J$!83VyY95jLk.n*i'=F=] /A$,d.$?sTGP} ʐVZKOxeVÊ0眥& fGd ?SSufkiG&*  R|Zo,Tһ* `'fSHg? [j!`uړ9dsq̮\@104-f0uFEgX XA4rvy+?'3+'CJ% 4ۺ egSeBj_{l4 V ̬qC3f#.Gd|,{.6̘Jl?b%反6Jgʠ~iHXg?04d\ ׄ->v$`PrϟXӁ[`)6b* ց(V 4!4j@?Ƽ ޏeo9&YU;8w,dea9I ҝ4*q71X+0\vِYϬ -'=O+1aIv2`'%'iY0m3((+8&ڠ՛>EL-mK~Z Qbt`ew=Jß3x]8 -X5A[y`{-Jze-p^ThܫVT%ڔUY}I,9i@ZRdIoI2hbUe4]Қssm6$[ݞ؊D\rH)wYZQ=gU-&\{J4ˎe}uhdu#;*2Z6-[3t=fk>2Aw* 7=W5֨ Mx; MCB( uv4"%0&G+ ׀cm7p?ٱS)]~$ZJ QB(J%<0O+̻uD:੤rrZD,+_ap=S E|(DŽݟڂ! 3m}w1kp4)8Brxv[x GX +&*[t@t"/??x& [0'?$5]3xL04)91"CA?> \*-Vt.o˦]w$Aiz ^FU1VoAHeo+nSt1wh(X (\ ^b)*gGZRv8kS ԫO?6n>Zo$] )zUcfA٢G°W*ٕ8w~#k_l>֝0$ Aʈasd^umzt},fΧ,vWɆƘ4ޯ86o!C v!+k7Q v(q|"W6*Z ĮF! `LeGnίBְul 1b&H t.*y!n-xc;F#K{CDE Jqy /DYa571 cb=j2v,?-rw{Q= >(*2.騾h| e2v cܭٶ-Mn^ڲR6"nD嘘ʇ#ЅQc'L ΨZMH[_p=_C*ܘfN:l9W:+0ŕ+' !lBΚ\6W/c&*5J (=F4V3)}u57+kԀkgc QN%ps:2.ۧǔWyy>h)㊆,jti#tkչ0m)h۝H;ۘwx'^-F+̜pxY36 ^r_L K ܲ1 FFk;B2C䐉͸h5|RvVm,ժ1q@qOVΜePѝCxߎ;NjaKz"dpl_ r /?=>?=Hq<@2yvzɱ/{9֫f) 6 K@ӂ0{R -Jg4JJ1+UDՏV:["Q[7ŏS|GG˦3L@ԇC7U.pH@I^X놬%)g $c0:/ǣ}ӠflEc!ʦNVͬk{nqސ-u+\(X.ಶnZxGW3sah@ G)b|[}c["6U 2 ']t8ijFi->4 3ׇy{2|*ʑ'/>毟: -)c3 ɓ=`΂,!jd"4pd`E"Z'q0A\I3o|J,`g8^7^kQ͑)fDg2bk FUG )&>b1reĐi`50ڼPg$2Vԯb1z=M"2i=]I'qX|}/>9-:N.jݦZmʇ̼4$ %K cᤞU}˱*'u\_WjbMՇ"IݭQnLЕl`ՎfbW7lr ۮ7,V1#05.BwUKC*_p.x6~#>6IuA@FEu[~#zwv83[( D)eD rkzdkI{Q"+ eyQ~J3[.JWkt9JNs*z)!Xbx'%LO&ybVO0is*Ⱦ.^To2QrZ39r_:M-:֎{ĮHª^2$%"QTXr0Uqt zMVYvEي=w*2RMg/+n&-UIiZʇsZ)Mq ]dH]h_ė-mPӑ<@:P"ɏx2';9[WP8%c.Ӝ7o>h5_D;̣;ucvS"6W: v 29>qhPr葨8ŝi$yzkoXdTx8:U9:@qsst!Q8g8ߛ&T7%1jv3qaظsӆrDXI^đ51Pd3i>imQy/݄Ve:DGR&Jq\6ډj"kX;4ҩވ@LIѷ z"Ƨ7 jŐbhJ=hV0e0#m 'RFĂھ E?(_rI/޾) Px8js3K=Uü2bƥCCei?@fBe3$9es{x}WʋrZo& 8 >ѱE0J)u7gu4\ ol+~ȒT~%($#;Yr]VQ=31h9u 8m5H\s(TzlU28jJb̳|h"qLLN&~TwE2By*)W{9h@伌e -fj[FRO\GǰI4zM{U2 ް️yY';?o&I ښL 뻿klgejCMיn)>n7_=*؋6^{SȽ6,pq:Cj&`6`C _ʇ8 lr*w?oqq6fyf5nRa5> S5»e ԒFo) {'e@qJ%؋(֓Xh_?Ki"j e =Zwn.FnCFJE)a>%td $yurH3%{9 }t+ μEGz`d *}2?>= z1狳Nn6?v,CUONRBPUj55Il}wfjIOis8Ify?x^KF| Y;r5p_+rHs'?t7JMЄiF-ôsljͮg`tk2-oIƝA*Cl1 r18"'|q' #Cn+*&d UE?(q,!~zbrr }Uڀ@ /}Ckv 8{N/s^J0T`!T~EM'H'ci2^oiW Jd2MJHuar =1o^X4zh2)mچt+/EݙI'8γ%wַ4qQT_d$@'878inE[E_<_7 r?u:NNrJw}xfKLWW6׬CР kAx!,!|'װ vdu%Ul"  B"D'K!=`Ϭ$ <ܰY ˴TPA ` TLGUw$qG,bsн׏E:5A?"ARh,({$Sؠ@!)8Z{uHLa:K=|骑i.J ?;Kt;UJ2QBJ#pgq%ETtIP֕1n_)5D9$ ѿPi]9Avf(Sa[/.#Ph!0ރҵwk8NdUxBťFURTփhnIATP!# GÔ]t'Ob ȵ3lEI[U!CD*%~M^,~S iMH /S=oR@z]ѪUma#l !々g,s &pJ/* Kb'[S&/vPM.]dh jB3{HZ~>.ZYAɞtA/A%"DS3!zF]r/c+/g80Ҁ}/ZɈǕ9$|‘ m, ՕƼ罞>@2VdVebTm_ $S0(h?Ej}v x+Q*PB{\$ GId,dCdABU业ȅqExpч]=Լ?J߷z49PQ8CGDBk PЄ"!@刅dWu:aDPp Q=wEq9L2y}s)V:EJZW%Ի.U+ۋhyLJBN{>.>B)_F!2 rdvI)UFbAj"eE-\VCcEʒE2:fHz۟RdFcK ^fBąf@#. >CQӴFACbZzT?+K*BG\aU\ $ƈE,#2{y%Cn 98n=''-j_(91Sc7|iP 9F*\`hGh^4OrQ,!ei9%}Ѽ7UKTSuN^ZJ"GݹHT5E}*VS_"RZ̯'#H[ 5#jeM4f=j!jXlyjT$,0C8') g&d +]HQz2j[HѨ@PUM"Hr[ &=Κ]JOl(9u'%TИj$r=Lz1O ۦ'g{)cp~a;N}&c;%.W4r,E} /yHt{瑕U=+}396O!j0QCgM-K6۽d"W^{埵AcbeqLd?`z)Lc^Ȁ uZ{$Gur_m{JpQ#6/"9odG*ZH볇vE~!D@ 9oZ](k hU! j=kF&Q辡q׼`ahV%0[8R%r(wur8Vշ\-WI{]]ک2[kF안B..;P# %6D( B.Ƙ1yb,rKiFؒk@Nu$8&/Igfga,B60MQl;;z,E[oPc \qЬIُjLi,:=p&D>K>XK?9dq{Wai nڋNQ S=2 앯~%ڬ+DJżx[PM~vlY}19 ;ی4Nr{epEYub&p.d|З9rZ:`U  3!u1f&=JV22q[ogwxi kkU/[(Vg}K]+5'm1,6tr\CM`鴎bge ӃmD ;C4Kj&)ByxCAL)(H|".VN\4 ɉ+BB0wP`}ܳgT(+C uD~L-`\TZtѠCS`f]>4 Qrբ&4ApRcIeLhM Cx[6ȅXm1gDcVIm{_Ydc(3ggfpf4r,i印$5Ye-1w( ӡB\ų)R:6se!oҙK9nb {qE.!-@g* - 3X\T s#2FY4TP;¿xSLE HAQ Q6#MeBW} 孂6#cdyי[tTkYFO{ zSY@a,?h ەPbr5^_7J/շjq΍l*2vSu/ftc70ѹX}6JuxZgUS wlJa{*4Fo0gEׇW\W$n!n[vnB*:)B-?$Z^%?Мb g1rS8[x$Eļ"MkKiGQKmB/78-7힟u̙-~pCrѝk}|bt.E^PZaEYٕVh.qnq/)jȇɃfZ=[:>񁽿lI"EvRm%{M nNVK +eh=p,_*͵D]Y?p`)Q=Nj",̫94E b]nQ{bʘz GBuQy_6ۿ}j)U BYCY,*I_ͯm]-1ŔXsCgu)GƏvօȒGl3DXGHhvB;exx[XL&Rv.vڊ&*r^ HUM"46y^%!Nq\XmT}ՅzQ"< &0=j~&Bd!:PMH;rNҮL.3ۑW,D0Op]űg=GWA4A47XoEݏ zm}S$T@+PITgԬc걎f 9y~ߣ^߽"J).S&jߑAI, kN/v`!& /&G,>7E"=?/Ugڱ8@fLB7қljّ丁M;m|7,- xތfUؚ|fL аIT@ח!>l3 {ηx'=#,T~Ԯq|tVPʒ aP< wVDi|cၰ8_Qyn,hj]UW%GQe}:aa+IF K Qh_MWӂ<` BVܟ1NrTz}Xwq1&i/-2``޶{sn@n8ۯtJzb!M mĎ* ;UX ]WDo~o3p0C]>^nyZꅕ8vdcoɮ6,eFWMW<50- oV.wuA|@K`#20(c5h3zQ3U|kxKZ7(t4o{WCYk?ߞ>}瘟<}/^.?^ӷM7M>)޻0P*Q.B?@[Iɝa -Iԛ c-qX,&#N'H2Vn^(\%KOqoP v^kiULc̄K7*/UOPYJmHlhs.U郦\\(К&~ f6o^mztGۗ׮Ғ0u{=eF閭$Ɓ;2:j.W$&3vb/+Wjy$Ȧi)Ǚh 7MVI–1Yr,l34ٚEm"]M6 F;imYj'sqa}jJ DWaR9e+I ;| {ov{Y*$iKOamFQ]gQKf&>?_Q\vAzT;wmz*1#N'00ϧy]~=JnHH6PYuybq"ynRλLAY |ɗ~>6=\&sÖzdg~GQHq“|&=$#e0‡aڹ?m%tK^d7GFbԍ_7V,lbs/fiӨ(@$Ўw=GFYYMYLJxA]'^>`]2> T;'Z/nk̾!GP{mj⸬'hʼ u/ݺp=#YŚb#\v3j4dJO}/ L;654Y^t͢;E604} P>Pc3EoҬZ;6Y  0scy /`Ƶϳ+'r2CbeN4fȭk0k/ys =lVuQVkE~3] {*U0/ _κ-Ryk;jDv8`4~R t &u^xfv3Ǧ@lISӱkU1X*t @L2 U,g ݪCDqNCߥNgd~^"܉ثΚB˦VpImx 4Y%,yjʣR R,Px [W_z` T֐xk97@0ztZ ^Z,ܙAηfKuu *uߜ!DP9av"28 }ɀɴTuKo;{1%s汋zD_9O6lʟ351|MOʽL$E6F<^0XA๭h{"Sk1G=d{i{1ĩC"pjLrkOLOO.0۽E:}r6g=N߽VZB`li{$=Z(T[ :LJm %FmXGMUo wSX3{T(LE x[(GL^%^?:VE{hVwVc N[;F b)վ@c`zg|FIL$0h{n9DZ^69:a#Z[dœCZyIx=6}LܨA{ѴaAf -ы` 7(SXkת _NiQwn`HJj]Qـ= I\8wKVٸ%\ܛXBԁ:w6^4HXB߷6' &붼iA 5FO"r-UzxɢK.Eѣd ^rMO>Sjg  \}#>Qo5-qRͦ,OدHrSso=ʬ;cf^LxMX*>$BZ%f맿/$_oFiCSA[!ӯiMe,5ֈBzܬ+=9&{o_OX}JޣI-(mê!FAq7KăYhbojj@'ڣʼ|VStP7tRr2BL`qCE'J9lu,2 t1.(. zE%%?>)@~[Ql)>k\PKv>2&S-X)GŒTBN;: #y <3r{m^]c `@ua_[rqk*q#Dlv5ln'|4֡Atqt  P7F1 -Kp Z\SafL̲ؗrs}νj97twpYa449UaB'?RΥ>?JihXk`c2:!cmeRґq­仄vmd @'ڡ})i9Ob$EsaЖi `QŊݜn-ȏ@n9igȆz 5k#ru)Ⱥ\8S?(" svm/7-b^!5sY2!%P'Rp dj1WEZB-{"C^M2'] @~re~@oXvS:HW +WӭG{ہЧd:ѩ#=AbըijG#ud^Yt2ZC%Ix6{P rLB# Qh!I0Co&+:p i#_qs9󮶟`!+YH=mcbUXw$DLXfgzr9 z-w`ʒ W R+NDpB.ӞEj16BaһM.".RPUzYTpnڳ]5&*,$gL+Kvo!Vjo`zFA壧v ӦM>T JuѨ szW<4֏v$yv%ibBݪb4p ǖE1z{λkp4s ӊ4wf 'C*%{;/e8mJ.jMH(V`[CsTW(Eٿ!'LJ:AYE ? D{CY37kɄ34?4d@1W+9`#)BNSf}[B8PTZK2$:9C+zS2s얬|ƆMyXY&ڲh\WU4B7 > M 4]@3t-³tw Gz/%ES63klr}>ڔSy왰xR/TZ e|glJ۞!I2Xus,Kr_V)c+r$Ls#Lcd&TP_HA]7R6èҞ%7rcBFqz*+ \lwlZiz%YG grl kzM=Fegѳr4:x̴Q6Z!CtاkݤZ9O[L, GNBzi9Pi/p{GX.6S/O-`Wc]9PEWd۬1B䆠L`-ߤRBY|_irs_%s{jιL XtrE*U")]iqc϶țX3։b\Q̔2).b!ׄBs]7YGZ.Ѯ/\iiyJ,#Z\Z\P.3杈V[][E ]d+ ٿms`b+}N 4$:B!#Io댈 UX}:<-!f=Zv))KA՛V]jx7 rxc/+ ^V^zynqjrQ(8MٿF^F@2߱]y1nFzʔT9!]fvz$R0%uonAT]薛9Ԣ./䒮LweNQY-̪mdVea(F$l+lOoPS#V *0zA:8Z5{ً<7r{V-_pRB{~D_.iXV]U_-ɭ8pߧ@LNP_H]sTXu~tJ=z^'ûDU?ꗑ?\Sn~\In xq$Jf+I5?^<׹ĵ՜EӅ=RdR7[]ɐ ֧(5tmbF a,?\jyA oRn<*cn^çS%^Y9{R"GcáYPJ%˛ɇq+1 HSw < sxD%G=eR)q+㆑sl0 Ag_а$+g"oGA|39Ջ7f+z]GOQ*A-K߲'҂7N+y5?2dG@oT6`t>X?LE,{%Kɑ%0 1ܓ)dsWi{X'afx/_\Zr1`;]WAԼgr"JP|z:WtuS/.BCd+ȤFR0] ތTx!`)k?Suwbuh,J M[V^DcW)ߦ1R@s_ 2SЈQtduՆJW&rTHc6IS8Xsj EntI#L.qHs@nRi2ArLMɠ)ks`*Zo;mP1hkr S&Bkg Y7RSh+/P}1 IVz[ Eo.y5$d#۵4c?,x]Nby33j%y}& g[O<(M4<`|k0V69E̐u}iHn`)#4F7A!G^EOQO#K{Q%'z%K)BI*K:p2-qt(zà !bŭhtEGZY 0rg"_ ^7k{Qrւd1̱E_ Bh-bDRz ^'k\gaU2!paxhc.=VEjFԮyitl&Ͻ,lo/dI& dN(},NCeKP-64I{ޅ:Y2/d,eJDnbLXmw[ j *6L2SK9R#`gܺmkx̔Cŧ*VC$ѩlSGD`H6gGWa9~ bX!ƒn/]վn9:hm.xr|gkl۷^2(s3/dM`Y l_ 2)a}NJ7e7סkC{cKLŃ vW)M/mT8@=x1$eP=t9)AJ9$2h`M[j7ʢx6gcH*.0CQݓwK_D-$sY3 ҳ8>dŢi=JUYEHF<)N,thyY&{ R" (}kZXyAU14tяxLkz8F~8~l&FCHq|q-qt#{o6fŮ-?J(cO."&~6%;몵[ v{,6R 8~gŠB`{MCX 2O)@~IwR^Zن|_|u+q m?4%| /N>(W;Ȝ7rP>ߑ+ } m$pNV²w<>mWX0޾7t(VNq)*anf+RffՆ>wP(p|\h;(!ï׉YM?*o]@2jGs<='>}Lw5>#p= }Nx\dmhR(Mf ΩL!~ F5SYߞvx [3l!zզaEE\á4Gw E3Ӂ!* B734>?*hpϟ|79LZZն(*rr/Ւ6 %G*$0ruK~?^}jŒc^0Z?ZLe166NJ.;t\cR4R=A:|pZ6UҬЃ'&GQ| %Hvv/5y`2Orfdd'x🽮;}Fo!oƽ3SVRRivUoWޥT=P h$gfުxĻ_S]U+;\ dP !ҧʃBOgQ'5AgICPF @!B'H]]^gRjO/ |"㤬tnudnlZ@J|0BDHp 5)m<0B\Y d2NV TC$*{]6^J J]RlPmυ7v+hIPXԼ#t!`.z6б>RK!0B7J!tpv"rn(gg_*v>(qRPhGsZv.G\M'm{/Ÿ1>upOkHð߿Ow FyBb7NJgVJ/T#qaU(b^kad& +wA+aTZ"05/|jdrIYrZ{*m$VN_xX>Yi<i֑ZWCG@AG—̹Rٖ\X%ioixV-zX4iD+.J6;)ׯPˠ?)2wӺ!^鷍!&T g0*yܕ ]QvUBςJd"$o5hQ9U(J 4ΠZΔ|OFWꉻGK "æb+.Yʌ[ے( -m[8-2.reς Uj&Ģ(ؖ"oy[MNv }K Uzn/vR9b|>b"˷X2fEXH ޠ N A$?=(S>NEwV,ʶ#J ߥRH!wP]Oǒ>Ż T+6<8Xp,{>/`O2OJRL9n$-5,ZLO[̤XUR8!?EH/ q=gCq R}3HinW,*¯~㻿r;:ƱϊrG}ZT?vͻ M;g:}!ΰj/ITcj9sĭPXaAt1/Ɵ4fQ{*k pDojh6\8Yi1_D:e4;>P 56tC$oRh􀼢 hּz)]WUwvN ޳;Cl~!"OE0n4`/C{JÜ %>J<+^6emvgR>M"Q|N';4ĥ泶~5JV-z뎱!HLO\}#i̕7485mpfl vMr*J·)< 5iuaa8fyb@Lr"tT <~ul5wpݧc7,Լ fLh[t9w]`2-<k^Ay;/{SZ`ŃgK`S)^/]ÏLtյEF`n642^ eL !H}a-5kR ,{4YqkT3xJOP(^~Jj*嫎PC\6j.0S_Y%Q!8m+j>%WB:'^W碑r\R61aljkE'!~m%Mt/cbwHR$ PmnU$"%3ξq'7>q's:%slal<卋JF"1\fڰlv1;3䛤,kf˜A`rHJ_O}{2+\^Ңuօ6dRg򥶐/M#$$Tf&RN>ov@C|U㯮a'wW(D0<*@$wX]ei_A^)E*t!ﮱ=~Hu8y)?nfHIp32U;]BCzzo|]MApw!#*JhF`dtUSxOJĴ_R?0+m 苖ꎺγp{Q漟vW`V|5<ǕMZ0d-hY["tT"V4zn&<i$\(RϠ!~2`}MgjȞյ߸Pc>s\w[j&IQvcy}1b s5Pfb}ע qAN .pDp:7f緌@<1{*PL䗸Аo w`}XϑޅAuÅ&n=i")ڙ }o,~=s TD"%vOq(W㡚hQry~Y ˊsuٲ R&1&T6;uvlXyTlpbM03@>ҊrH]\Bwyy_@Gɣ-OsC;W|Osf6s[9[\HF˨g5Z ?3ε!-OsPTJn貨1`M߯|}s,6߸ݓ5fg V%vLL7)fUCo!VZZc7On%JP:.PcHMs ymwNP5FЗvFT)XP)Nc_o#:o~_h=C,؆f,"4}#1 }TU`> stream xZnG}xBbd:2X`YhqqCqZfERE—SU]]]CI0*! ORXR^Bz(T*T,%-+#,' BGt00mDH{e z_ !/@ )dF?D2& 2NJ2ޢȄ&+,!+u,%0::Z@9]HClR O$')#&}a%raO.8 bdH2 Uym,e{,ac>*PpZQPr`$?q X2V$Xk,BXUy(4?%Q¡Q1<\f l83f'(ZDz<{ "2(+&)$Kv̂2~yD%O LE拠D""KIX;   uLY.PG#Si# #:̈wČhr駢~4cE ?1V79.g:ӛP,(G7jJ_t:i߫[p`,GSI' ԏz}  ̡«笞N0A~:.=ge=VÛ2 ={uLѧ`zKEKT BهdGE ϒ/TvTD|!s! b?\pF#=%u3hZ{Y%X}=n),z:U8:luD %]5g{_]`?]xr\{d0 H4iT1McƵ`w嬺^3brN]^ hgۿD%"qӿʋyv|ذ_I,[)hMJ5 N4Mo ~h&іTHٓh3"8kdqd\xUl/2l5yǩd%OD h>^5E#ɦխ g̳2t>j',w8Epbُ9bJW+?-"䒺7B &7_ wLzviCh:YĵƂDk6(&mDF!!B%eXY?w$JQ?rEbߡrYsK-m<*E'I4jh+.ш52&c `/ݟaذgp$/ё|Gglp5@ Qd gB(d iB&d kBրKM ݄M ą^ruS)&f cbI&f eb$f I*`=APWWWWXUVp1u)}ڥik? TJȠR:Lb:uˢ [`rQ,jYVBru{Ce= OW >?D>qI8]sJeSHgt;WUS.> ھ ?0)'C:gώo&Mu+4ƣ,!/[8R;yJߪ`9G$۳켣I?oNy9b\ItwMf$ir|G,\:z/3wi۷< :Fk*.'sW׾eĵo#.m˛#aSձiJb$T<e6j7>Frq8^w5O k!sQO@cuf<]ow=+:Q:΁u8خǴ !;]F#f4h^<f6DtJz4w6ݎfsO0JÆN{X^~C\vV,Uv?I!i㏁^umPSL"#u-UiV$jXҹl*T@jjm%t{%*Gjcp~{ud.6ݫ&d+ܿ66AܹS*?ooi?>}-cƃonFj6eCC#/ϋk祏+祯ƫMyfռ5JJ Ϳmo,rk+ѱ8kahǷܕőq_qiU{߭nڳ!$å9O^{爵Vղ'}Jk}ZߺַkW UF5mkdb'-݈ 9cx֧Hh=⣖h~ڱSrZn u"(H}Ku{adMG3>5×DBѷZ> stream H endstream endobj 237 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Length 192 /FunctionType 0 /BitsPerSample 8 >> stream }{}x{~vy|twyqtworulprjmphknehkbfi`cf]ad[^aX[^UY\RVYOSVMPSJMPGJMDGJ@DG=AD:>A7:=37:036,03(,/$(+ #&"  endstream endobj 238 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 156 /FunctionType 0 /BitsPerSample 8 >> stream H‹C _$%D>r|~O<{?kX4]ݺ/~[|.ekq^fm2lBqR\\H6ʁO D?rBY3LLhQ{Iv5`aV5*!U(|܃q endstream endobj 239 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Length 192 /FunctionType 0 /BitsPerSample 8 >> stream ~}{}z|y{}xz|wx{uwztvxstwqsuprtnpsmoqkmpjlnhjmgikegjdfhbdgace_ad]_b[^`Z\_XZ]VY[TWZSUXQSVORTMPSKNQILOHJMFHKDGIBEG@CE>AC> stream H  ""VϛW1,J0S, 42,Ħ--MCKhHF(4) rQqԳ\2BWXe6۲nxnǵ;O\o`Loa endstream endobj 257 0 obj << /BBox [148.123 480.928 158.483 474.928] /Group 322 0 R /Filter [/FlateDecode] /Length 120 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 323 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream Hw6PH.V0C<.}wPz1BQ*WW!PB/Pw{)D((eCr!@ $Tk`. endstream endobj 259 0 obj << /BBox [147.23 474.856 159.23 468.496] /Group 325 0 R /Filter [/FlateDecode] /Length 119 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 326 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HL 0WlbL+-zsR-~2 B_0=OHx՘a_v?4)w endstream endobj 261 0 obj << /BBox [147.634 415.515 157.994 409.515] /Group 327 0 R /Filter [/FlateDecode] /Length 120 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 328 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream Hw6PH.V0C<.}wPz1BQ*WW!PB/Pw{)D((eCr!@ $Tk` endstream endobj 263 0 obj << /BBox [146.887 421.947 158.887 415.587] /Group 329 0 R /Filter [/FlateDecode] /Length 120 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 330 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HL 0WlҐسBbn)ZA 0,MH|9}H?Ě3U]8kʫ6ћ~$%bev8{>$:e6f._ 2n_j`  endstream endobj 265 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 90 /FunctionType 0 /BitsPerSample 8 >> stream Hl‰ [Ry,Eqr>G㹾{msY+c^KK\JXcwօ!:TPjB9$]ji endstream endobj 266 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 117 /FunctionType 0 /BitsPerSample 8 >> stream H @/'K~ZC͙Jԕ?֍T5-چ(mtKvَ}8c?pF? s> uSΔyx_7ayXRON{ endstream endobj 267 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 119 /FunctionType 0 /BitsPerSample 8 >> stream H,‡0 qg\ti^Vk+cKsL^wqn/+nau8[XtڠUJm2Bi!5 ŸDaP>Q6#`> stream H‡ {&sٟPTBjTFjUjS؆f[7욖}u=ѻa}q9 en\~p?N'}ݑwdOz̒ RO endstream endobj 269 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 88 /FunctionType 0 /BitsPerSample 8 >> stream H4‰0{?,A2;>ԽU-r)B'Z4qcvkXjKŔ d3>׍`} endstream endobj 270 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 85 /FunctionType 0 /BitsPerSample 8 >> stream H4‡ 0w7C$|~ҧku+>A)$13rfX:;;^|O6Ь endstream endobj 271 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 157 /FunctionType 0 /BitsPerSample 8 >> stream H4gC0ߩ-jS{bId}ߓ+*U!*8L~1z&rbr' 놖u e8A0L=t}vUӖuSTu^VYQyydQQ|b?5 ) endstream endobj 272 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 58 /FunctionType 0 /BitsPerSample 8 >> stream Hd {R`ė:&^\ܐ@p9i+:7= |{ endstream endobj 273 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 50 /FunctionType 0 /BitsPerSample 8 >> stream H| R(K>6sPYj" C`{^ endstream endobj 274 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Length 192 /FunctionType 0 /BitsPerSample 8 >> stream ſý endstream endobj 275 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 188 /FunctionType 0 /BitsPerSample 8 >> stream H$‡ Pϝ-L{D1 1mB_8Gr7 Fb(Q@p 'hdH*O,p ˳"/H("ɪUSkJYe5jXVnNh:'l^~wc;z{~ (>)Irܮ00u^ endstream endobj 276 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 172 /FunctionType 0 /BitsPerSample 8 >> stream H ف&^ _+ʢH*+fne[ v} \/"?( 48q ,Oa,P^KTj\]I0~$D0qfӼLtF;[e;םok??/X endstream endobj 277 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 126 /FunctionType 0 /BitsPerSample 8 >> stream H$ 'Gɋs ;۞Oy{?k;p[e;y{]Vf抗T3S%D 8&낅`u`B! ͸\R&G&d^~>az endstream endobj 278 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 125 /FunctionType 0 /BitsPerSample 8 >> stream H  7. ' dRZjk{K{J}rTZX%cc> stream H7B) [Xw9Xr xA6Fv=I&)Yr$p ^DIYV/&njqukٞ~Aq%YIV2˫[Q彨eTnG7c7LL 0W2YU endstream endobj 280 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Length 192 /FunctionType 0 /BitsPerSample 8 >> stream endstream endobj 281 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 181 /FunctionType 0 /BitsPerSample 8 >> stream Hw#74%-%igYMuazn}ԷjeUuVTi^&YydFipI0C l׷l'[7-8ILY5$EeMT^T8AfyD('i1Bq!a!hw_;.t endstream endobj 282 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 183 /FunctionType 0 /BitsPerSample 8 >> stream Hw4iR /sZ -(`0#$pޑ{bH@Y?pˋ ,H(QPuS;Yicڮx;^/ȿAq%Y^Ev-󢺕uQ5eVͽnͽk5 > stream H<‹ '* ْG\ʔ2=9V^Bذ2j%on8P-vk~1կnO\|w endstream endobj 284 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 156 /FunctionType 0 /BitsPerSample 8 >> stream H,  GWjޚVόYy~GznzB|SeU.V8|L&Mt3Diqq7AvA_jڲEeUIVIY+ "/ߴw͸=:nh endstream endobj 285 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 49 /FunctionType 0 /BitsPerSample 8 >> stream H\ KO`wAb> stream ſþ½ endstream endobj 287 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 33 /FunctionType 0 /BitsPerSample 8 >> stream Hڳ^ڍ@G{B}x@l endstream endobj 288 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 32 /FunctionType 0 /BitsPerSample 8 >> stream HڳA ڋSڇ < endstream endobj 289 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 161 /FunctionType 0 /BitsPerSample 8 >> stream H ‡ J]AA=#Xv-۳v} \?4 8Ќ(4K<@ "PPQEJL*\cBIM e5m(ጷ x+N쥒jJAzd<˼noyym<> 09 endstream endobj 290 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Length 192 /FunctionType 0 /BitsPerSample 8 >> stream ƿü}~z{~wx{tuxprtmoqjlnghkdeg`ad]^`YZ]VWYRSUOOQKKMGGICCE??A;:<757202-+,(%&# endstream endobj 291 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Length 192 /FunctionType 0 /BitsPerSample 8 >> stream ~}~{}z{~xz|wx{uwytuxrtvprtopsmoqlmpjlnijlghkegidegbce`ad_`b]^`[\^YZ]XY[VWYTUWRSUQQSOOQMMOKKMIIKGGIEEGCCEAAC??A==>;:<9897575342020./-+,+()(%&&"## endstream endobj 292 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Length 192 /FunctionType 0 /BitsPerSample 8 >> stream ~|~z|yz}wx{uwysuwqsupqtnorlmpjknhjlfhjdfhcdfabd_`b]^`[\^YY\WWZUUWSSUPQSNOQLLNJJLHHJFEGCCEAAB?>@<;=:9:767434201/-.,)*)&'&#$# endstream endobj 293 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 173 /FunctionType 0 /BitsPerSample 8 >> stream H D0(A-1v}yy^qmn˺248 C9-cMꦭꦬjZV-fyfygqFqFq$H$|=z=ŶZ1mX04,4T*MQV |D#H?z endstream endobj 294 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 184 /FunctionType 0 /BitsPerSample 8 >> stream H[)m-*-i!*xi ӷn~lڡnӖu>.U^E=i~OF$At "/q}Yմ]rΦ'PԳ|%EeU^"{#4GR,gp I#`! ڀv Q{ endstream endobj 295 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 16 /FunctionType 0 /BitsPerSample 8 >> stream HRWP >G endstream endobj 296 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Length 192 /FunctionType 0 /BitsPerSample 8 >> stream # &#$)&',*+/-.202535878:9;=<>??ABACDDFGFHIIKKKMMNPPPRRRTTTWVWYXY[Z[]\]_^_b`adbcfdfhfhjhjljlnlmpnorpqtrsvtuxuwzwy{y{}{}}~~ endstream endobj 297 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Length 192 /FunctionType 0 /BitsPerSample 8 >> stream # '$%+)*/-.313757:9;>=?AABDDFGGIJJLMNPPQSSTVVWYYZ\\\_^_babddegfhjijmkmonorprtsuwuwzxz|z|}~ endstream endobj 298 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 17 /FunctionType 0 /BitsPerSample 8 >> stream H:  endstream endobj 299 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 155 /FunctionType 0 /BitsPerSample 8 >> stream H D k/$$S%̻ 1{n{k/c~uN'8zR#ԃRrPTB\wu-2ҲPLZܴ5&uUYQfJsd' ݵ1 endstream endobj 300 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 151 /FunctionType 0 /BitsPerSample 8 >> stream H ‡ JlH3B$7͓i9¨&%&1frqEe#J7(mivm]׻1 q#4N3e^Vۺ}ۏ8x^~ ~ۤ1 endstream endobj 306 0 obj << /BBox [148.123 480.928 157.843 475.888] /Group 344 0 R /Filter [/FlateDecode] /Length 121 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 345 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HL 0W٤)ƳP4SBAKA׻)ðcǴwAʐ?JfP֝p36L_ ;> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream Hw6PH.V0C<.}wPz1BQ*WW!PP\\D? c R!@~H9bC]*Rw5Pp 0< g endstream endobj 310 0 obj << /BBox [147.59 474.856 158.39 473.056] /Group 348 0 R /Filter [/FlateDecode] /Length 119 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 349 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream Hw6PH.V0C<.}wPz1!(JJ**232W(W0Qb/XlH2R26DWr \  endstream endobj 312 0 obj << /BBox [147.59 474.496 158.39 469.816] /Group 350 0 R /Filter [/FlateDecode] /Length 121 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 351 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream Hw6PH.V0C<.}wPz1BQ*WW!PB/P{{)D((eCr!@ $Tk`&!A endstream endobj 314 0 obj << /BBox [148.274 414.555 157.994 409.515] /Group 352 0 R /Filter [/FlateDecode] /Length 122 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 353 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H 0D&`{X(PMz 2,˼{1B+ٻo&'S7qbF DIcĚSg7c^CTR2}`n<g endstream endobj 316 0 obj << /BBox [148.274 414.915 157.994 410.235] /Group 354 0 R /Filter [/FlateDecode] /Length 122 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 355 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H @ DwV=+-{+=mU=~YB| 1dHNJqb*wCe{m1b`YB>{*>` QO?gp endstream endobj 318 0 obj << /BBox [147.727 417.387 158.527 415.587] /Group 356 0 R /Filter [/FlateDecode] /Length 119 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 357 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream Hw6PH.V0C<.}wPz1!(JJ*2(W0Qjb/XlH2R27DWr \ "6 endstream endobj 320 0 obj << /BBox [147.727 420.627 158.527 415.947] /Group 358 0 R /Filter [/FlateDecode] /Length 118 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 359 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HL 0WY% JOV4_,0u!eWܙ;K탆&7-6Pym;lOy*)#3qnxiLq/cX1Lr0;f endstream endobj 323 0 obj << /BBox [148.123 480.928 158.483 474.928] /Group 360 0 R /Filter [/FlateDecode] /Length 124 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H> /ColorSpace << /CS0 40 0 R >> >> >> stream H4NK C1{ /|ouB? ap%q'Jh`Z)Jf wx9%A όxqo8@*&ĭzL E:TbEr2yE+ ' endstream endobj 328 0 obj << /BBox [147.634 415.515 157.994 409.515] /Group 362 0 R /Filter [/FlateDecode] /Length 127 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream HDLA0 @Í3D dq1Lur֓q7,׈**RP19~wY@J%eՌV!_ \ϴrg'J(! endstream endobj 330 0 obj << /BBox [146.887 421.947 158.887 415.587] /Group 363 0 R /Filter [/FlateDecode] /Length 145 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H4NI 1 @4q'>ϡ'.)3eےy!MN`eǛϝ(zo\JcIY{ O`f.όQrǐPrFP_1;5~ jM//p4( endstream endobj 331 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Length 192 /FunctionType 0 /BitsPerSample 8 >> stream TTVTTVTTWTUWTUWUUXUVXVWYVWYWXZXY[YY\YZ\Z[][\^\]_]^`^_b_`cabdbcecdfdehfgighkhjljknkmomnqnprpqtqsvsuwuvyvx{xz|z|~|}~ endstream endobj 332 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 174 /FunctionType 0 /BitsPerSample 8 >> stream H0O Hww3rh޽^88N&ib(ay8^IeQR$YMQuU34 K7mrL۵v} \/ L(,J8͓HseԠl@ՖuW5na-~aZM mAu;~mǽq=V} endstream endobj 333 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 84 /FunctionType 0 /BitsPerSample 8 >> stream HDY @)"הdΝ.!V> stream ~|~{}y{~xz|vx{uvysuwrsvprtopsmoqlmpjknijlghkegidegbcfabd_`b]^`[\_Z[]XY[VWYUUWSSVQRTOPRNNPLLNJJLHHJFFHDDFBBD@@B>>@<<=:9;878646 endstream endobj 335 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Length 192 /FunctionType 0 /BitsPerSample 8 >> stream 646878:9:<;=>=?@?ABACCCEEEGGGIIIKKKMLLNNNPPPRQRTSSVUUWVWYXY[YZ\[\^]^`^_a`acabecdfdfhfgigikijmjlnlmpmoqopsprtrsvsuwtvyvwzwy{yz}z|~{}}~ endstream endobj 336 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Length 192 /FunctionType 0 /BitsPerSample 8 >> stream 98998998998::9:;:;;:<<;==<>>=??>@@?AAABBBDDCEEEGFFHHHJIIKKKMMMONNPPPRRRTTTVUVXWXZYZ\[\^]^a_`cacedegfgihiljknlnpopsqrusuwvwzxz|z|} endstream endobj 337 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Length 192 /FunctionType 0 /BitsPerSample 8 >> stream 989:9;<;=>=???AAABCBDDDFFFGGGIIIKJJLLLNMNPOOQPQSRRTSTVUUWVWYWXZYZ\Z[]\]_]^`^_b`acabdbdfdegefifhjhikijmjlnkmomnqnoroqsqrursvsuwtvxuwzwx{xz|y{}z||}}~~ endstream endobj 338 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 16 /FunctionType 0 /BitsPerSample 8 >> stream H  H9= endstream endobj 339 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Length 192 /FunctionType 0 /BitsPerSample 8 >> stream QRTTUWWXZZZ]\]__`bacedehghjijmkmonorprtstwuwywy|z{~|~~ endstream endobj 340 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Length 192 /FunctionType 0 /BitsPerSample 8 >> stream ľ»|~yz}uwyqsumoqjkmfgiabe]^`XY\TTWOOQ endstream endobj 341 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 164 /FunctionType 0 /BitsPerSample 8 >> stream H ‰D O\WD"3*_(4N$i ,@se+,QYjPԸŘ4mג%t뇮g=et0 lbei~o—XظBB :2RuX}8maOcq޺˞pn><`׌L endstream endobj 342 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Filter [/FlateDecode] /Length 176 /FunctionType 0 /BitsPerSample 8 >> stream H0otwft>׻w??yoǵzL>0t vc 붫Xְڼly2E8͢qD^~x[gZa:akjK&ʪ )(s&_ A8Aa8bő'@п{Z2 endstream endobj 343 0 obj << /Size [64] /Order 1 /Range [0 1 0 1 0 1] /Decode [0 1 0 1 0 1] /Domain [0 1] /Encode [0 63] /Length 192 /FunctionType 0 /BitsPerSample 8 >> stream ľ¼~}~{| endstream endobj 345 0 obj << /BBox [148.123 480.928 157.843 475.888] /Group 364 0 R /Filter [/FlateDecode] /Length 126 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 365 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H 0DlؤgAMa  1 endstream endobj 347 0 obj << /BBox [148.123 480.208 157.843 475.528] /Group 366 0 R /Filter [/FlateDecode] /Length 126 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 367 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H; 0D=\J\;H.?`pBgb0VwF`ej_h ӛ zd\8 ,[TN5D3}IHcؘCaL;t1._~ endstream endobj 349 0 obj << /BBox [147.59 474.856 158.39 473.056] /Group 368 0 R /Filter [/FlateDecode] /Length 127 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 369 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H10 Ew_M;SĀȆ:Z *gls RCl>dNLnzkZXUOKzD.`Qژ4M_V[0,t]G\ endstream endobj 351 0 obj << /BBox [147.59 474.496 158.39 469.816] /Group 370 0 R /Filter [/FlateDecode] /Length 128 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 371 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H0 Ew5I;@Bbb  Pc{l@طi @orGӏB^#o{hT> w(%"&b "lʖb@*_V3%hUf endstream endobj 353 0 obj << /BBox [148.274 414.555 157.994 409.515] /Group 372 0 R /Filter [/FlateDecode] /Length 126 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 373 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H 1}y7h} XNx)|z7 QP*}Ce"wQCRW1b)`Y! '#b9/ /Ϳ/MX endstream endobj 355 0 obj << /BBox [148.274 414.915 157.994 410.235] /Group 374 0 R /Filter [/FlateDecode] /Length 126 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 375 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H 1}y7rW+ N*^ލ|QP*KjyQ|6pLSQ9E,ӕn!3 {Ng9 VM` endstream endobj 357 0 obj << /BBox [147.727 417.387 158.527 415.587] /Group 376 0 R /Filter [/FlateDecode] /Length 125 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 377 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H @ yyIwizW*ĽO* >ȲYP*5ZcZ?*i2ΐ8Qr;-Ɗ#OEpϫo{-KЉ~ c  endstream endobj 359 0 obj << /BBox [147.727 420.627 158.527 415.947] /Group 378 0 R /Filter [/FlateDecode] /Length 125 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /XObject << /Fm0 379 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 40 0 R >> >> >> stream H 1 yyӴ[ڽ+ 7T@paw!0>jrgL@YsȈ41U4b]>31Zq|1\A[*{Y߾/-G 0~ endstream endobj 365 0 obj << /BBox [147.042 482.008 158.922 474.448] /Group 380 0 R /Filter [/FlateDecode] /Length 102 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ProcSet [/PDF /ImageC /ImageI] /XObject << /Im0 381 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 382 0 R >> >> >> stream H P {O&p=D)2B(u] Dq 8]4=#6D WUPx"NsOz5ڰ endstream endobj 367 0 obj << /BBox [147.042 482.008 158.922 474.448] /Group 383 0 R /Filter [/FlateDecode] /Length 103 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ProcSet [/PDF /ImageC /ImageI] /XObject << /Im0 384 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 385 0 R >> >> >> stream H 1 Q E>x+$ߗI XQF~N{8K} QhZ>厷l7'Zeflؔݹ™j,Y>.e7?r M endstream endobj 369 0 obj << /BBox [146.511 475.936 159.471 468.736] /Group 386 0 R /Filter [/FlateDecode] /Length 101 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ProcSet [/PDF /ImageC /ImageI] /XObject << /Im0 387 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 388 0 R >> >> >> stream H A0 DѽO1'pljc'{$ꪭ Ϫlv\_+:d$8ژŀyh3Y|vY;q;9c4 endstream endobj 371 0 obj << /BBox [146.511 475.936 159.471 468.736] /Group 389 0 R /Filter [/FlateDecode] /Length 102 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ProcSet [/PDF /ImageC /ImageI] /XObject << /Im0 390 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 391 0 R >> >> >> stream H ;P Dޫ8ǟ Q" U@K{{yh- Sx!F~bC;HFS,桛1})5c\"v endstream endobj 373 0 obj << /BBox [147.195 415.995 159.075 408.435] /Group 392 0 R /Filter [/FlateDecode] /Length 102 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ProcSet [/PDF /ImageC /ImageI] /XObject << /Im0 381 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 382 0 R >> >> >> stream H A @ }N/`3J  Py-Ұ@i6q2+]2i$ېQU9Ʉ[hU0eo endstream endobj 375 0 obj << /BBox [147.195 415.995 159.075 408.435] /Group 393 0 R /Filter [/FlateDecode] /Length 104 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ProcSet [/PDF /ImageC /ImageI] /XObject << /Im0 384 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 385 0 R >> >> >> stream H 1 A >ϘL&XZewЖ7j;J|r[Y7L NKjDUeE)ӓ9Ъ`.e'\ endstream endobj 303 0 obj << /N 96 /Type /ObjStm /First 842 /Filter [/FlateDecode] /Length 946 >> stream xWnF|W=`Xɉ`$ oB,"=Srª3%D ]F#++'IQH#*i6\@W (2%gB)ǎ2L9Ǟ B% ހ29 ){G,`8@/HLs44z0'Ms6t &4)X;6Hx$pQ%XFi$?ӄĄiƢ).dL 9b$00Ŝ B2XP$b! +"b#&:$%D$W28 ,.!T 6 BR-vJA_` "6F $ulI eŒB u`TX(5s룶I-8fKN1wSpÔ 6ت"1 *s%5ٳ~I5w۶:&T4vln߾[T_nz|檹j䪋n~}lq߻fߒ؏n[Sћ^tnlYxMp}g7r?̎|KGgyj0u(j>ue nR#է{Çd|+Xo~sVz[\OO}ßn#W𩋤e;>YJ%" Fv|W{, : 1u|c~x ~i %|j:ͥc1CT7Ƨ5=3$wF^9}͝_QKo_|_&qbzyʦx[5;+̘ ;,/yC~ fK endstream endobj 377 0 obj << /BBox [146.646 421.707 159.606 414.507] /Group 395 0 R /Filter [/FlateDecode] /Length 103 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ProcSet [/PDF /ImageC /ImageI] /XObject << /Im0 387 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 388 0 R >> >> >> stream H 1@ ޯY_|GB DP7syj[>F04|r[Y7ŚV%j` L1Vx^v`, endstream endobj 379 0 obj << /BBox [146.646 421.707 159.606 414.507] /Group 396 0 R /Filter [/FlateDecode] /Length 103 /Matrix [1 0 0 1 0 0] /Subtype /Form /Resources << /ProcSet [/PDF /ImageC /ImageI] /XObject << /Im0 390 0 R >> /ExtGState << /GS0 324 0 R >> /ColorSpace << /CS0 391 0 R >> >> >> stream H 1@ ޯY_|GB DP7syj[Q\c;rz,ִd$8/VSýofc\L endstream endobj 381 0 obj << /Name /X /Type /XObject /Width 33 /Decode [0 255] /Filter [/FlateDecode] /Height 21 /Intent /RelativeColorimetric /Length 269 /Subtype /Image /ColorSpace 382 0 R /BitsPerComponent 8 >> stream Hԑ R0 E eIZֲZ hؖf gg<]D$aB?",r_!e 9z78<(ۥ7x;tP_a:툞b0/ h $QPMJs/A=*SLa-GN_ofMmtp`@PV/n(O=+DjCl/? lPPHuYXlpD>I.{zN8huo#}0u endstream endobj 384 0 obj << /Name /X /Type /XObject /Width 33 /Decode [0 255] /Filter [/FlateDecode] /Height 21 /Intent /RelativeColorimetric /Length 216 /Subtype /Image /ColorSpace 385 0 R /BitsPerComponent 8 >> stream HQW0 ({R ^aQJZ}$!|%aT~YJqa P3ȳpR|0sv z=XUT)U(ڵopvbqXTvc %ZK#M.<#y5m_= [ iW{I{t0F٥N]=l9c|<)f󁲯'1^] endstream endobj 387 0 obj << /Name /X /Type /XObject /Width 36 /Decode [0 255] /Filter [/FlateDecode] /Height 20 /Intent /RelativeColorimetric /Length 131 /Subtype /Image /ColorSpace 388 0 R /BitsPerComponent 8 >> stream H DKD[/4oOtBfe!F`Ct66zLU("<]r-S288nIp%Ĝ|$QK˺uBj?[-XI endstream endobj 390 0 obj << /Name /X /Type /XObject /Width 36 /Decode [0 255] /Filter [/FlateDecode] /Height 20 /Intent /RelativeColorimetric /Length 330 /Subtype /Image /ColorSpace 391 0 R /BitsPerComponent 8 >> stream HlRRPPĊ+vAŨF `xgxw/GLf^ AcWVPM  @ǰH8.+h1/~Ep-HqUum(ƍiW\W?-\r&ai0JB}q6h$Utr/ьxhGm;3Q$]>*6Uf1?~T0~ioNoR?*P|f5,vg{2"c𩍆i.51276ݓλ։z?ߘvG'oY?WcO`_=BI2Yw$G?+&6 endstream endobj 397 0 obj << /Length 177 >> stream z{~wx{uvyqrulmojknfgiefhbceaacZZ\TUWRRTOOQHHJFFHAAC>=?=<>5354232/1/-..,--*,,)*+()*'()%&($%&#$%"#$ !# endstream endobj 398 0 obj << /Length 120 >> stream ͻ~~|}wx{stwoprjknghjZ[]OOQGGIEEGCBDAAC?>@<;<;9;:8:7675351./.,--*,+()*'()%&($%&#$%"#$ !# endstream endobj 399 0 obj << /Length 90 >> stream z{~xy{uvytuxtuwstwrsvqrtmnpijl_`bGGI@@A?>@;9;535312+())%&($%&#$%"#$ !# endstream endobj 400 0 obj << /Length 285 >> stream Ŀýxy|wx{uvytuxrsvqruqrtoprmnqjkndeg`ac_`b^_a]^`\]_[\^ZZ\WWYVWYSTVSSURRTNNPKKMGGIEEGCBDAAC@@A?>@>=?<;<;9;:8:8784233122/11./.,--*,,)*+()*'()%&($%&#$%"#$ !# endstream endobj 394 0 obj << /N 14 /Type /ObjStm /First 109 /Filter [/FlateDecode] /Length 186 >> stream x=0 =n'n,!؀ 1T&T$=J{;3dp2<|&|5!0 Q#RP"W kOgnýƹ:lawCۍ};4vOcwϾ.7G{NQN, <2450B4B606C54E9EB49FE8E1F25CDC06>] /Info 1 0 R /Root 2 0 R /Size 402 /Type /XRef /Filter /FlateDecode /Length 936 /DecodeParms << /Columns 5 /Predictor 12 >> >> stream x͖kLq'I: -,rT u!FEMJZ.cl4"kt©4\C'ߏ\ޙ΋>?sEgW!bB'Z!il$ܮH!J;ʈA/ne?yL"RGjaQŎ::mp*_ه㘾DhDW]tI,qiv)iw~ѩء'FC ;7'vd%W&WXIa61o3% ʜ:\tvNd{O{*Wɻ3yuewќG'fēɹ|y-lkһ38$'qmZJ9M>;'iVjGG<5jrrA;6h ƹhS:HbM% [{Iiokgw.`R#dVC`J$ ^& ,p2<"Lz=pЇ駡{Sa4=]o=N$-巚|y|\?YBUg.:.VkRսI+_5pIN' ̩.9yxBIxBu}Z>PX Ϙo<O |,<-8De_%ԋaj*tQeKi/5;]u`_*$H| <?>?!^~> xae1|nh<~N|N£GËޞ]g>QY{#_KJ ҐC8xin|x7ݦzИ5I) mf|H};fC=IM]> f GZSfs'߉V_-UUc endstream endobj startxref 838742 %%EOF